Q8N5N4 CC022_HUMAN

Gene name: C3orf22
Protein name: Uncharacterized protein C3orf22

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NY64 SLC2A8 0.88492 carbohydrate metabolic process GO:0005975
cell cycle GO:0007049
membrane organization GO:0061024
...
2 Q8TBJ4 PLPPR1 0.88492 anatomical structure development GO:0048856
signal transduction GO:0007165
3 Q5JVL4 EFHC1 0.88492 anatomical structure development GO:0048856
cell cycle GO:0007049
cell division GO:0051301
...
4 O00623 PEX12 0.88115 cellular protein modification process GO:0006464
protein targeting GO:0006605
protein transport GO:0015031
...
5 Q8N653 LZTR1 0.86396 anatomical structure development GO:0048856
cellular protein modification process GO:0006464
signal transduction GO:0007165
6 Q96L94 SNX22 0.85661 protein transport GO:0015031
transport GO:0006810
7 Q9BZR9 TRIM8 0.83191 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 P41273 TNFSF9 0.7941 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
9 Q4LDE5 SVEP1 0.77981 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
10 O75147 OBSL1 0.77538 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...

                                           20                  40                  60                  80                 100
AA:                      MDSSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFTSPSGSCPAPLPAPSPPPLCNL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDD....................................................................DDDDDDDDDD......
DO_IUPRED2A:             DDDD.D....DD...........................DDDDDDDDDDDD....DDDD.......D.....DD.D.DDDDDDDDDDDDD..........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....
CONSENSUS:               DDDDDDDDDDDDDDDD.......................DDDDDDDDDDDD....DDDD.......D.....DDDDDDDDDDDDDDDDDDDDDD......
CONSENSUS_MOBI:          ....................................................................................................
RICH_[P]:                                                                                           PdftsPsgscPaPlPaPsP      

                                          120                 140                   
AA:                      WELKLLSRRFPRQLAFLLSTRHTEAACPQTSKAAGLSRGLS
STMI:                                                             
DO_DISOPRED3:            ....................DDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ...........................DDDDDDD.DDDDD.
DO_SPOTD:                ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ....................DDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........................................
RICH_[A]:                                        AAcpqtskAA