List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q96M85	n/a	0.95448
2	Q53QZ3	ARHGAP15	0.95024	anatomical structure development GO:0048856 cell morphogenesis GO:0000902 signal transduction GO:0007165
3	Q4VX76	SYTL3	0.93995	protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192
4	O43825	B3GALT2	0.91155	biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular nitrogen compound metabolic process GO:0034641 ...
5	Q9BPV8	P2RY13	0.90397	signal transduction GO:0007165
6	A5PLK6	RGSL1	0.89551
7	P19827	ITIH1	0.89445	small molecule metabolic process GO:0044281
8	P48960	ADGRE5	0.88116	cell adhesion GO:0007155 cell-cell signaling GO:0007267 immune system process GO:0002376 ...
9	Q8WUJ0	STYX	0.87584	catabolic process GO:0009056 cellular protein modification process GO:0006464 nucleocytoplasmic transport GO:0006913 ...
10	O43639	NCK2	0.86921	anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ...

                                           20                  40                  60                  80    
AA:                      MGIEKRFNVLKIKVTQLQCHMGRRPGCECSWELRAPVTVASFLWSPTDSGHLPLLQDTSGPPEGTHRTFTPGRELVLGPKPTVPGKPFLASALLNV
STMI:                                                                                                                    
DO_DISOPRED3:            DDDD............................................................................................
DO_IUPRED2A:             ....................................................DDDDDDDDDDDDDDDDDDDDDDDDDD.D................
DO_SPOTD:                DDDDD....................................................DDD..DDD..............................D
CONSENSUS:               DDDD.....................................................DDDDDDDD...............................
CONSENSUS_MOBI:          .....................................................DDDDDDDDDDDDDDDDDDDDDDDD...................
RICH_MOBI_[T]:                                                                    TsgppegThrTfT