Q96M85 YV008_HUMAN
Protein name: Putative uncharacterized protein FLJ32756
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9Y535 | POLR3H | 0.95448 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
2 | Q9H9P2 | CHODL | 0.95448 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 |
3 | Q53QZ3 | ARHGAP15 | 0.90699 |
anatomical structure development
GO:0048856 cell morphogenesis GO:0000902 signal transduction GO:0007165 |
4 | Q4VX76 | SYTL3 | 0.89716 |
protein transport
GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
5 | O43825 | B3GALT2 | 0.87006 |
biosynthetic process
GO:0009058 carbohydrate metabolic process GO:0005975 cellular nitrogen compound metabolic process GO:0034641 ... |
6 | Q9BPV8 | P2RY13 | 0.86282 |
signal transduction
GO:0007165 |
7 | A5PLK6 | RGSL1 | 0.85475 | |
8 | P19827 | ITIH1 | 0.85373 |
small molecule metabolic process
GO:0044281 |
9 | P48960 | ADGRE5 | 0.84105 |
cell adhesion
GO:0007155 cell-cell signaling GO:0007267 immune system process GO:0002376 ... |
10 | Q8WUJ0 | STYX | 0.83597 |
catabolic process
GO:0009056 cellular protein modification process GO:0006464 nucleocytoplasmic transport GO:0006913 ... |
20 40 60 80 100
AA: MSHSRRAAPTQDQCHTPGFPTSRETSGSIWQARICGSLQALDTWRTHIPRKSPAPTQASQICLLLPESPWRNPTPRGFLKPLINWDAILYFKEKRNIQVT
STMI:
DO_DISOPRED3: DDDDDDDDDDD..DD.....................................................................................
DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDD......D.....D..........D.......................D
DO_SPOTD: DDDDDDDDDDDDDDDDDD.DDDDDD...........................................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD.............................................................................
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................................................
RICH_MOBI_[T]: TqdqchTpgfpTsreT
120 140 160
AA: TQAHPQNQASCSSQEVATPGLVPQAAAPKVYERSHDNLNAEAQGLAGAQVSKPQNPITRLCSLKEQSILKIFTKQSI
STMI:
DO_DISOPRED3: ............................................................................D
DO_IUPRED2A: DDDDDDDDDDDDDDDD..........DDD..DDD..DDD.DDDDDDDDDD...........................
DO_SPOTD: ..DDDDDDDDDDDDDDDDDD.............DDDDDDDDDDDDDDDDDDDDD.....................DD
CONSENSUS: ..DDDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDD..........................D
CONSENSUS_MOBI: .............................................................................
RICH_[AN]: NlNAeAqglA