Q8N6N6 NATD1_HUMAN

Gene name: NATD1
Protein name: Protein NATD1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q7Z4R8 C6orf120 0.86193 cell death GO:0008219
immune system process GO:0002376
transport GO:0006810
...
2 Q8N653 LZTR1 0.848 anatomical structure development GO:0048856
cellular protein modification process GO:0006464
signal transduction GO:0007165
3 Q9C029 TRIM7 0.8155 cellular protein modification process GO:0006464
4 P55058 PLTP 0.8064 biosynthetic process GO:0009058
reproduction GO:0000003
small molecule metabolic process GO:0044281
...
5 Q96QD5 DEPDC7 0.80506 signal transduction GO:0007165
6 P81605 DCD 0.78849 biological process involved in symbiotic interaction GO:0044403
immune system process GO:0002376
response to stress GO:0006950
7 O75503 CLN5 0.78488 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
8 O15212 PFDN6 0.76822 cellular component assembly GO:0022607
protein folding GO:0006457
protein-containing complex assembly GO:0065003
9 P51854 TKTL1 0.76339 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
10 Q9H0T7 RAB17 0.72701 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...

                                           20                  40                  60                  80                 100
AA:                      MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD.....................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDD....................................................................................
CONSENSUS:               DDDDDDDDDDDDDDD.....................................................................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[A]:                 AhsAAAvplgA                                                                                        

                                
AA:                      ENPLPQYLERLQP
STMI:                                 
DO_DISOPRED3:            .............
DO_IUPRED2A:             .............
DO_SPOTD:                ...........DD
CONSENSUS:               .............
CONSENSUS_MOBI:          .............