Q8N7P3 CLD22_HUMAN
Gene name: CLDN22
Protein name: Claudin-22
List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- cell junction organization GO:0034330
- cellular component assembly GO:0022607
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P16415 | ZNF823 | 0.99906 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q86XU0 | ZNF677 | 0.82674 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q7Z5A9 | TAFA1 | 0.79633 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 4 | Q8NE22 | SETD9 | 0.73715 | signal transduction GO:0007165 |
| 5 | P60509 | ERVPABLB-1 | 0.73715 | |
| 6 | Q96RQ9 | IL4I1 | 0.68135 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 7 | Q96NN9 | AIFM3 | 0.67572 | cell death GO:0008219 |
| 8 | Q9UKW6 | ELF5 | 0.67572 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 9 | O43699 | SIGLEC6 | 0.6585 | cell adhesion GO:0007155 cell-cell signaling GO:0007267 |
| 10 | Q9HAA7 | n/a | 0.6327 |
20 40 60 80 100 AA: MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGF STMI: MMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDD.DD.DD........................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDD............................................................................................. CONSENSUS: DDDDDD.... ................................................... CONSENSUS_MOBI: .......... ...................................................
120 140 160 180 200 AA: GLDCLRIGESQRDLKRRLLILGGILSWASGVTALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLHCAACSSHAPLASGHYA STMI: MM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...........................................................................................DDDDDDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: ..........................................................................................DDDDDDDDDD CONSENSUS: ............... .......................... ......DDDDDDDDD CONSENSUS_MOBI: ............... .......................... ............... RICH_[H]: Hya RICH_[HQ]: Hya