Q7Z5A9 TAFA1_HUMAN
Gene name: TAFA1
Protein name: Chemokine-like protein TAFA-1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O43676 | NDUFB3 | 0.82554 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 |
| 2 | Q8IW03 | SIAH3 | 0.82554 | anatomical structure development GO:0048856 catabolic process GO:0009056 protein targeting GO:0006605 ... |
| 3 | Q9NP94 | SLC39A2 | 0.8151 | transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | P16415 | ZNF823 | 0.79708 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q8N7P3 | CLDN22 | 0.79633 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 6 | Q9NUM3 | SLC39A9 | 0.72243 | transport GO:0006810 |
| 7 | Q96EU7 | C1GALT1C1 | 0.67942 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 8 | P05154 | SERPINA5 | 0.66202 | anatomical structure development GO:0048856 membrane organization GO:0061024 reproduction GO:0000003 ... |
| 9 | Q86XU0 | ZNF677 | 0.65853 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q9P0M4 | IL17C | 0.62696 | cell-cell signaling GO:0007267 response to stress GO:0006950 signal transduction GO:0007165 |
20 40 60 80 100 AA: MAMVSAMSWVLYLWISACAMLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEP STMI: SSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDD.............................................................. CONSENSUS_MOBI: ................................................................................. RICH_[H]: HgslqHtfqqHHlH RICH_[HQ]: HgslQHtfQQHHlH RICH_fLPS_[H]: cHgslqHtfqqHHlH
120 AA: CLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT STMI: DO_DISOPRED3: .........................D.DDDDDD DO_IUPRED2A: ............................DDDDD DO_SPOTD: ..........................DDDDDDD CONSENSUS: ...........................DDDDDD CONSENSUS_MOBI: .................................