Q8N8H1 ZN321_HUMAN

Gene name: ZNF321P
Protein name: Putative protein ZNF321

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UNK0 STX8 0.68677 immune system process GO:0002376
membrane organization GO:0061024
protein transport GO:0015031
...
2 Q9BPX7 C7orf25 0.68677
3 Q9Y243 AKT3 0.61427 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell population proliferation GO:0008283
...
4 Q96M32 AK7 0.60774 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
5 Q9GZL7 WDR12 0.60774 cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
...
6 Q0VD86 INCA1 0.5849 cell cycle GO:0007049
cell death GO:0008219
cell population proliferation GO:0008283
...
7 P31749 AKT1 0.56075 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 A8MPS7 YDJC 0.55885 carbohydrate metabolic process GO:0005975
9 Q99965 ADAM2 0.55885 cell adhesion GO:0007155
membrane organization GO:0061024
nervous system process GO:0050877
...
10 Q9Y487 ATP6V0A2 0.55659 catabolic process GO:0009056
homeostatic process GO:0042592
immune system process GO:0002376
...

                                           20                  40                  60                  80                 100
AA:                      MMKEFSSTAQGNTEVIHTGTLQRHESHHIRDFCFQEIEKDIHNFEFQWQEEERNGHEAPMTEIKELTGSTDRHDQRHAGNKPIKDQLGSSFHSHLPELHI
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
CONSENSUS_MOBI:          ....................................................................................................
RICH_[E]:                                                            EfqwqEEErnghEapmtEikE                                   
RICH_[T]:                       TaqgnTevihTgT                                                                                
RICH_[DH]:                                                                                     DrHDqrHagnkpikD               

                                          120                 140                 160                
AA:                      FQPEWKIGNQVEKSIINASLILTSQRISCSPKTRISNNYGNNSLHSSLPIQKLGSTHERKIFPM
STMI:                                                                                    
DO_DISOPRED3:            ................................................................
DO_IUPRED2A:             ...............................DDDDDDDDDDD...DDDDDD...DD..D.DD.D
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....
CONSENSUS:               ...............................DDDDDDDDDDDDDDDDDDDDDDDDDDDD.....
CONSENSUS_MOBI:          ................................................................
RICH_fLPS_[N]:                                           trisNNygNN