List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q99611	SEPHS2	0.97014	biosynthetic process GO:0009058 small molecule metabolic process GO:0044281
2	Q8IUH3	RBM45	0.91974	anatomical structure development GO:0048856 cell differentiation GO:0030154
3	Q6ZRV3	LINC00696	0.8812
4	A2IDD5	CCDC78	0.88089	anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ...
5	Q8N1Y9	n/a	0.87503
6	A8MV23	SERPINE3	0.86193
7	Q96BZ9	TBC1D20	0.83896	anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ...
8	Q9H598	SLC32A1	0.83101	anatomical structure development GO:0048856 cell-cell signaling GO:0007267 transmembrane transport GO:0055085 ...
9	Q8IY22	CMIP	0.82965	anatomical structure development GO:0048856 embryo development GO:0009790
10	Q96PH1	NOX5	0.80565	anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ...

                                           20                  40                  60                  80                 100
AA:                      MTMTMSYKAIEKIPRCSWNREEPGEQWNKIYSVETGLLGTYSFEWQSQVANKTMRKRNTNSICGRQHEPHCPVSITRAIAQPQLLTFPDSLASRGGHMTQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDD.................................................................................................
DO_IUPRED2A:             ...................................................D...DDDDDDDDDDDD.....DD...............DDDD..DDDD.
DO_SPOTD:                DDDDDD.............DDDDD...........................DDDDDDDDDD.....DD................................
CONSENSUS:               DDD................................................DDDDDDDDDD.....D.................................
CONSENSUS_MOBI:          .........................................................................................DDDDDDDDDDD
RICH_MOBI_[G]:                                                                                                         GGhmtq