Q8NCU1 CC197_HUMAN
Gene name: CCDC197
Protein name: Uncharacterized protein CCDC197
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y2U9 | KLHDC2 | 0.81229 | |
| 2 | A3KMH1 | VWA8 | 0.73886 | |
| 3 | Q9BXS9 | SLC26A6 | 0.73661 | anatomical structure development GO:0048856 cell differentiation GO:0030154 developmental maturation GO:0021700 ... |
| 4 | Q9UHC6 | CNTNAP2 | 0.7305 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | Q13621 | SLC12A1 | 0.69841 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | Q9C099 | LRRCC1 | 0.69219 | cell cycle GO:0007049 cell division GO:0051301 |
| 7 | P01275 | GCG | 0.68792 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell death GO:0008219 ... |
| 8 | Q6IN97 | FRMPD2B | 0.67012 | cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 9 | Q9NVL8 | CCDC198 | 0.66087 | |
| 10 | Q6PGQ1 | DRICH1 | 0.63949 |
20 40 60 80 100 AA: MAAMDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYLIKVLEKIPEGCTGWEEPEEVLVEATVKHYGKLFTASQDTQKRLEAFC STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............................................................................... RICH_[AM]: MAAMdtgqrA RICH_MOBI_[AM]: MAAMdtgqrA RICH_MOBI_[D]: DtgqraDpsnpgDkegD
120 140 AA: QMIQAVHRSLESLEEDHRALIASRSGCVSCRRSATASRSSGGS STMI: DO_DISOPRED3: ...............................DDDDDDDDDDDD DO_IUPRED2A: ......................................DDDDD DO_SPOTD: ...............DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...............................DDDDDDDDDDDD CONSENSUS_MOBI: ...........................................