Q8NEE0 KLAS1_HUMAN

Gene name: KLHL30-AS1
Protein name: Putative uncharacterized protein KLHL30-AS1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6ZSA8 n/a 0.52137
2 Q5T653 MRPL2 0.50206 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
3 P01160 NPPA 0.45556 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q8N2F6 ARMC10 0.4454 cell death GO:0008219
growth GO:0040007
signal transduction GO:0007165
5 Q8N6T3 ARFGAP1 0.41197 protein transport GO:0015031
response to stress GO:0006950
signal transduction GO:0007165
...
6 Q9UPQ9 TNRC6B 0.41045 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 Q9NQZ8 ZNF71 0.39608
8 Q7Z6Z6 PNPLA5 0.36374 catabolic process GO:0009056
homeostatic process GO:0042592
9 Q66K80 RUSC1-AS1 0.34128
10 O00522 KRIT1 0.33602

                                           20                  40                  60                  80                  
AA:                      MCLRSHFKVAFTQRKVELSKELRRSRSSRNGGLPLQEQPMGQKWGWHRGEPGHPRMEELNEWPQNGDHWSRKWPPPCAFTPG
STMI:                                                                                                      
DO_DISOPRED3:            DD................................................................................
DO_IUPRED2A:             .................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDD...DDD
DO_SPOTD:                DDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDD.D..DDDDDDDD....................DDDDDDD
CONSENSUS:               DD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDD
CONSENSUS_MOBI:          .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[QW]:                                                  QeQpmgQkWgW                                    
RICH_[RS]:                                 SkelRRSRSS                                                      
RICH_[GW]:                                             GGlplqeqpmGqkWGWhrGepG                              
RICH_[HW]:                                                          WgWHrgepgH                             
RICH_MOBI_[QW]:                                             QeQpmgQkWgW                                    
RICH_MOBI_[W]:                                                      WgWhrgepghprmeelneWpqngdhWsrkW         
RICH_MOBI_[EW]:                                                     WgWhrgEpghprmEElnEW                    
RICH_MOBI_[GM]:                                                 MGqkwGwhrGepGhprM                          
RICH_MOBI_[GW]:                                        GGlplqeqpmGqkWGWhrGepG                              
RICH_MOBI_[HW]:                                                     WgWHrgepgH                             
RICH_MOBI_[MW]:                                                 MgqkWgWhrgepghprM                          
RICH_MOBI_[NW]:                                                                     NeWpqNgdhW             
RICH_fLPS_MOBI_[W]:                                                 WgWhrgepghprmeelneWpqngdhWsrkW