Q8NH08 O10AC_HUMAN
Gene name: OR10AC1
Protein name: Olfactory receptor 10AC1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O95484 | CLDN9 | 0.80506 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 2 | Q11130 | FUT7 | 0.77002 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 3 | Q96BI1 | SLC22A18 | 0.74329 | transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | Q6ZMZ3 | SYNE3 | 0.72122 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 cytoskeleton organization GO:0007010 ... |
| 5 | Q9H9A6 | LRRC40 | 0.70711 | |
| 6 | P16066 | NPR1 | 0.66154 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 7 | Q9GZZ9 | UBA5 | 0.65288 | cellular protein modification process GO:0006464 nervous system process GO:0050877 response to stress GO:0006950 ... |
| 8 | Q86XM0 | CATSPERD | 0.643 | anatomical structure development GO:0048856 cell differentiation GO:0030154 developmental maturation GO:0021700 ... |
| 9 | P05111 | INHA | 0.63466 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 10 | P55075 | FGF8 | 0.63057 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MDSPSNATVPCGFLLQGFSEFPHLRPVLFLLLLGVHLATLGGNLLILVAVASMPSRQPMLLFLCQLSAIELCYTLVVVPRSLVDLSTPGHRRGSPISFLS STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDD.............................................................................................. CONSENSUS: DDDDDD.................... .......... ...................... CONSENSUS_MOBI: .......................... .......... ......................
120 140 160 180 200 AA: CAFQMQMFVALGGAECFLLAAMAYDRYVAICHPLRYAAVVTPGLCARLALACCLRGLAVSVGLTVAIFHLPFCGSRLLLHFFCDITALLHLACTRSYADE STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: . ......................... ... ........ CONSENSUS_MOBI: . ......................... ... ........
220 240 260 280 300 AA: LPLLGACLVLLLLPSVLILASYGAIAAALRRLRCPKGRGKAASTCALHLAVTFLHYGCATFMYVRPRASYSPRLDRTLALVYTNVTPLLCPLIYSLRNRE STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ...................... .................................... CONSENSUS_MOBI: ...................... ....................................
320 AA: ITAALSRVLGRRRPGQAPGGDLREL STMI: DO_DISOPRED3: ..........DD.DDDDDDDDDDDD DO_IUPRED2A: ...................DDDD.. DO_SPOTD: ..........DDDDDDDDDDDDDDD CONSENSUS: ..........DDDDDDDDDDDDDDD CONSENSUS_MOBI: ......................... RICH_[GR]: RRRpGqapGG