Q8NHZ8 CDC26_HUMAN

Gene name: CDC26
Protein name: Anaphase-promoting complex subunit CDC26

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell division GO:0051301
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A0A1B0GUA6 CCDC195 0.64681
2 Q6NXR0 IRGC 0.57761
3 P31947 SFN 0.57256 anatomical structure development GO:0048856
cell cycle GO:0007049
cell death GO:0008219
...
4 P52790 HK3 0.56976 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
5 A4D2B0 MBLAC1 0.55959
6 Q9UHB9 SRP68 0.55494 protein targeting GO:0006605
protein transport GO:0015031
transport GO:0006810
7 Q9UNE7 STUB1 0.53898 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
8 Q6NSZ9 ZSCAN25 0.53229
9 Q9NWK9 ZNHIT6 0.51934 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
protein-containing complex assembly GO:0065003
...
10 Q70Z44 HTR3D 0.50314 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...

                                           20                  40                  60                  80               
AA:                      MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF
STMI:                                                                                                         
DO_DISOPRED3:            DD................................DDDDDDDDDDDDDDDDDDDD..........................D....
DO_IUPRED2A:             .D..D................DDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
DO_SPOTD:                DDDDDDDDDD...........D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS_MOBI:          ..........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[G]:                                                       GGsdGeGaiG                                    
RICH_[K]:                                       KdletrKKqK                                                    
RICH_[EG]:                                         EtrkkqkEdvEvvGGsdGEG                                       
RICH_[GV]:                                                  VeVVGGsdGeGaiG                                    
RICH_[IN]:                                                                           INdrIgykpqpkpNN          
RICH_[KV]:                                            KKqKedVeVV                                              
RICH_fLPS_[G]:                                                  GGsdGeGaiG                                    
RICH_MOBI_[G]:                                                  GGsdGeGaiG                                    
RICH_MOBI_[N]:                                                                        NdrigykpqpkpNN          
RICH_MOBI_[EG]:                                    EtrkkqkEdvEvvGGsdGEG                                       
RICH_MOBI_[GV]:                                             VeVVGGsdGeGaiG                                    
RICH_MOBI_[IN]:                                                                      INdrIgykpqpkpNN          
RICH_MOBI_[KV]:                                       KKqKedVeVV