Q8TAB7 CCD26_HUMAN

Gene name: CCDC26
Protein name: Putative coiled-coil domain-containing protein 26

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P18075 BMP7 0.89443 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
2 Q96LQ0 PPP1R36 0.848
3 Q96RD7 PANX1 0.78488 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
4 O43897 TLL1 0.75698 anatomical structure development GO:0048856
cell differentiation GO:0030154
extracellular matrix organization GO:0030198
5 P60228 EIF3E 0.75682 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular component assembly GO:0022607
...
6 Q9C0A0 CNTNAP4 0.74329 cell adhesion GO:0007155
cell-cell signaling GO:0007267
7 O95758 PTBP3 0.73058 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 Q96RQ1 ERGIC2 0.71067 transport GO:0006810
vesicle-mediated transport GO:0016192
9 Q8NFJ6 PROKR2 0.70711 signal transduction GO:0007165
10 O14718 RRH 0.70711 cellular protein modification process GO:0006464
nervous system process GO:0050877
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MERLCLQPGLLPTAVYLPHWERSSRDREEKEAPFFRLLSRRLMFCVHARQRTQNVPINKYQRLVVKMKEEEALREKLNMQNITHKENQNAGSLEMIDNML
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             .....................DD...................................................DDDDDDDDDDDDDDDDDDDDDDD...
DO_SPOTD:                DDDDD.....................................................................DDDDDDDDDDDDDDDDD.........
CONSENSUS:               D.........................................................................DDDDDDDDDDDDDDDDD.........
CONSENSUS_MOBI:          ....................................................................................................
RICH_[N]:                                                                                             NmqNithkeN             

                                    
AA:                      KQEERRELK
STMI:                             
DO_DISOPRED3:            ......DDD
DO_IUPRED2A:             ......DDD
DO_SPOTD:                DDDDDDDDD
CONSENSUS:               ......DDD
CONSENSUS_MOBI:          .........