Q8TAD7 OCC1_HUMAN

Gene name: OCC1
Protein name: Overexpressed in colon carcinoma 1 protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O14904 WNT9A 0.7417 anatomical structure development GO:0048856
cell cycle GO:0007049
cell death GO:0008219
...
2 Q9BX73 TM2D2 0.73513
3 Q9H1K6 TLNRD1 0.72943
4 Q14103 HNRNPD 0.72938 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 Q9P253 VPS18 0.72356 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell-cell signaling GO:0007267
...
6 Q9BZ76 CNTNAP3 0.71963 cell adhesion GO:0007155
7 Q9UMF0 ICAM5 0.71769 cell adhesion GO:0007155
extracellular matrix organization GO:0030198
immune system process GO:0002376
...
8 Q9P217 ZSWIM5 0.71459 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
9 Q9BV19 C1orf50 0.7144
10 Q15758 SLC1A5 0.70601 cellular component assembly GO:0022607
circulatory system process GO:0003013
protein-containing complex assembly GO:0065003
...

                                           20                  40                  60                 
AA:                      MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN
STMI:                                                                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD.DDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
RICH_[AG]:                GcGnstAtsAGAGqGpAGAA                                          
RICH_[A]:                       AtsAgAgqgpAgAA                                          
RICH_[G]:                 GcGnstatsaGaGqGpaG                                            
RICH_[V]:                                       VteesVteddkrrnyggVyVglpseaV             
RICH_[VY]:                                      VteesVteddkrrnYggVYV                    
RICH_fLPS_[A]:                 tAtsAgAgqgpAgAA                                          
RICH_MOBI_[AG]:           GcGnstAtsAGAGqGpAGAA                                          
RICH_MOBI_[A]:                  AtsAgAgqgpAgAA                                          
RICH_MOBI_[G]:            GcGnstatsaGaGqGpaG                                            
RICH_fLPS_MOBI_[A]:            tAtsAgAgqgpAgAA