Q8TBB0 THAP6_HUMAN
Gene name: THAP6
Protein name: THAP domain-containing protein 6
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UJW7 | ZNF229 | 0.77152 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q6ZN57 | ZFP2 | 0.65465 | |
| 3 | Q6UQ28 | PLET1 | 0.61203 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 4 | Q86UW2 | SLC51B | 0.51889 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 protein targeting GO:0006605 ... |
| 5 | Q8WU49 | C7orf33 | 0.4844 | |
| 6 | Q3ZCU0 | GVQW3 | 0.46291 | |
| 7 | Q03924 | ZNF117 | 0.46291 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q5JVG2 | ZNF484 | 0.46291 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q8NGX6 | OR10R2 | 0.45682 | signal transduction GO:0007165 |
| 10 | Q8NGV6 | OR5H6 | 0.43644 | nervous system process GO:0050877 signal transduction GO:0007165 |
20 40 60 80 100 AA: MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDVLCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQGKRE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .............................................................................................DDDDDDD CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: KLHCRKNFTLKTVPATNYNHHLVGASSCIEEFQSQFIFEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQET STMI: DO_DISOPRED3: ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D.......................................... CONSENSUS: ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[EF]: EEFqsqFiFE RICH_[FI]: IeeFqsqFIF RICH_[HN]: NftlktvpatNyNHH RICH_fLPS_[F]: ieeFqsqFiF
220 AA: ANRLDTFCWDCCQESIEQDYIS STMI: DO_DISOPRED3: ................DDDDDD DO_IUPRED2A: ...................... DO_SPOTD: ............DDDDDDDDDD CONSENSUS: ................DDDDDD CONSENSUS_MOBI: ......................