List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular protein modification process GO:0006464
- protein targeting GO:0006605
- protein transport GO:0015031
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q6ZN57	ZFP2	0.79262
2	P61956	SUMO2	0.60971	catabolic process GO:0009056 cellular protein modification process GO:0006464
3	Q9Y287	ITM2B	0.60971	anatomical structure development GO:0048856 biosynthetic process GO:0009058
4	Q8WU49	C7orf33	0.58649
5	Q3ZCU0	GVQW3	0.56047
6	Q9UJW7	ZNF229	0.56047	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
7	Q5JVG2	ZNF484	0.56047	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
8	Q9NR50	EIF2B3	0.54127	anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ...
9	Q8TBB0	THAP6	0.51889
10	P32456	GBP2	0.47855	immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEK
STMI:                                                       MMMMMMMMMMMMMMMMMMMMM                                            
DO_DISOPRED3:            DDDDDDDDDDDDD............................................................D..D.......................
DO_IUPRED2A:             DDDDDDDDDDDDDDD.............................................DDDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDD.....
DO_SPOTD:                DDDDDDDDDDDDDD..........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDD.....................                     ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....
CONSENSUS_MOBI:          ...................................                     ............................................
RICH_[EK]:                                                                              KEKmqppEKE                           
RICH_[HN]:                                                                                             HldeakdHNslNN         

                                          120            
AA:                      PNLAQVELELKERDVLSVFLPDVPETES
STMI:                                                
DO_DISOPRED3:            ......................DDDDDD
DO_IUPRED2A:             ............................
DO_SPOTD:                .......................DDDDD
CONSENSUS:               .......................DDDDD
CONSENSUS_MOBI:          ............................