Q8TBR5 CSAS1_HUMAN

Gene name: CIRBP-AS1
Protein name: Putative uncharacterized protein CIRBP-AS1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q99598 TSNAX 0.84031 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...
2 Q9Y3A2 UTP11 0.76115 anatomical structure development GO:0048856
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
3 Q6QEF8 CORO6 0.75406 cytoskeleton organization GO:0007010
4 Q5XG85 n/a 0.75398
5 Q9NRA2 SLC17A5 0.75135 transport GO:0006810
6 Q96NB1 CEP20 0.75065 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
7 Q9NRC8 SIRT7 0.74815 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell cycle GO:0007049
...
8 A8MTB9 CEACAM18 0.7436
9 Q9BT56 SPX 0.72828 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
circulatory system process GO:0003013
...
10 Q8IYR6 TMEFF1 0.72452 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...

                                           20                  40                  60                  80                 100
AA:                      MAPEVIRQDFQAGEVAFRRTGYLRGRSVLTQTKHSLAGNGRHPVALRTRLGSLALGAVPTWTKLWAQSTTWQTRNHTRTGHAYPRFTRPSFPSCNRNGKR
STMI:                                                                                                                        
DO_DISOPRED3:            DD..................................................................................................
DO_IUPRED2A:             ................................DDDDDDDDDDD............................D..DDDDDDDDDDDDDDDDDDDDDDDD..
DO_SPOTD:                D..............................DDDD.DDD..............................D...DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               D...............................DDDDDDD...................................DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ............................................................................DDDDDDDDDDDDDDDDDDDDDD..
RICH_[R]:                                                                                             RtghaypRftRpsfpscnR    
RICH_[NR]:                                                                                                             NRNgkR
RICH_MOBI_[R]:                                                                                        RtghaypRftRpsfpscnR    
RICH_MOBI_[FR]:                                                                                       RtghaypRFtRpsFpscnR    

                                    
AA:                      RKLRLGLPY
STMI:                             
DO_DISOPRED3:            .........
DO_IUPRED2A:             .D..D....
DO_SPOTD:                DDDDDDDDD
CONSENSUS:               DDDDD....
CONSENSUS_MOBI:          .........
RICH_[NR]:               RklR