Q8TD86 CALL6_HUMAN
Gene name: CALML6
Protein name: Calmodulin-like protein 6
List of terms from Generic GO subset, which this protein is a part of:
- cytoskeleton organization GO:0007010
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8TD90 | MAGEE2 | 0.66286 | |
| 2 | P16473 | TSHR | 0.62392 | cell population proliferation GO:0008283 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 3 | Q8WVV4 | POF1B | 0.6135 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
| 4 | Q9GZQ4 | NMUR2 | 0.58915 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 5 | Q9H9Q4 | NHEJ1 | 0.58434 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q15935 | ZNF77 | 0.57309 | |
| 7 | Q9H1L0 | MIR1-1HG | 0.56443 | |
| 8 | Q96G30 | MRAP2 | 0.56443 | generation of precursor metabolites and energy GO:0006091 homeostatic process GO:0042592 signal transduction GO:0007165 |
| 9 | Q96SA4 | SERINC2 | 0.5533 | |
| 10 | Q5T5M9 | CCNJ | 0.55322 | cell cycle GO:0007049 cellular protein modification process GO:0006464 mitotic cell cycle GO:0000278 |
20 40 60 80 100 AA: MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ DO_IUPRED2A: .................DDDD.DDDDD...............................................DDDD...................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[Q]: QQeislQpwchhpaescQ RICH_[CQ]: QQeislQpwChhpaesCQ RICH_[CT]: ChhpaesCqTTTdmT RICH_[HQ]: QQeislQpwcHH
120 140 160 180 AA: YHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLIQ STMI: DO_DISOPRED3: .................................................DDDDDDDDDDD....................D DO_IUPRED2A: .............................................DDDDDDDDDDDD........................ DO_SPOTD: ...........................................................................DDDDDD CONSENSUS: .................................................DDDDDDDD.......................D CONSENSUS_MOBI: .................................................................................