Q96G30 MRAP2_HUMAN

Gene name: MRAP2
Protein name: Melanocortin-2 receptor accessory protein 2

List of terms from Generic GO subset, which this protein is a part of:
- generation of precursor metabolites and energy GO:0006091
- homeostatic process GO:0042592
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q15436 SEC23A 0.93888 cellular component assembly GO:0022607
immune system process GO:0002376
membrane organization GO:0061024
...
2 Q99062 CSF3R 0.83205 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
3 Q9GZQ4 NMUR2 0.79612 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
homeostatic process GO:0042592
...
4 Q9NP58 ABCB6 0.78935 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
5 P35228 NOS2 0.78633 biosynthetic process GO:0009058
catabolic process GO:0009056
cell population proliferation GO:0008283
...
6 Q9NWZ3 IRAK4 0.78488 cell population proliferation GO:0008283
cellular protein modification process GO:0006464
immune system process GO:0002376
...
7 O00180 KCNK1 0.74901 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810
8 P16473 TSHR 0.74126 cell population proliferation GO:0008283
cell-cell signaling GO:0007267
homeostatic process GO:0042592
...
9 Q92959 SLCO2A1 0.71202 transport GO:0006810
10 Q9BSM1 PCGF1 0.70711 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...

                                           20                  40                  60                  80                 100
AA:                      MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFMFFVLTLLTKTGAPHQDNAESSEKRFRMNSFVSDFGRPLEP
STMI:                                                                MMMMMMMMMMMMMMMMMMMMM                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDDD........................................................D.D.DDDDDD..................
DO_IUPRED2A:             .........................................................................DDDDDDD....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDD....................DDDDD...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD............................                     .......DDDDDDDDDD..................
CONSENSUS_MOBI:          ............................................                     ...................................

                                          120                 140                 160                 180                 200
AA:                      DKVFSRQGNEESRSLFHCYINEVERLDRAKACHQTTALDSDVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQNYFGEDDLLISEPPIVLETKPLSQTS
STMI:                                                                                                                        
DO_DISOPRED3:            .........................DDDDDDDDDDDDDDDDDDDDDDD.DD.........................................DDDDDDDD
DO_IUPRED2A:             .DDDD......................................DDDD.DDD.D.D..DD.................................DDDDDD.D
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.DDDD..DDDDDDDDDDDD..DDDD...DDDDDDDD
CONSENSUS:               .DDDD....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................DDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[Q]:                                                 QttaldsdvQlQeairssgQ                                               

                                        
AA:                      HKDLD
STMI:                         
DO_DISOPRED3:            DDDDD
DO_IUPRED2A:             DDDDD
DO_SPOTD:                DDDDD
CONSENSUS:               DDDDD
CONSENSUS_MOBI:          .....