Q8WUR7 CO040_HUMAN

Gene name: C15orf40
Protein name: UPF0235 protein C15orf40

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96C28 ZNF707 0.65862 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q9H788 SH2D4A 0.63732
3 Q13415 ORC1 0.62734 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
4 Q69YN2 CWF19L1 0.61574 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
5 Q13214 SEMA3B 0.61558 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
6 Q9BWS9 CHID1 0.60579 carbohydrate metabolic process GO:0005975
immune system process GO:0002376
response to stress GO:0006950
...
7 O94903 PLPBP 0.60179
8 Q86UG4 SLCO6A1 0.60038 transport GO:0006810
9 Q86WX3 RPS19BP1 0.59578
10 O75683 SURF6 0.58828 ribosome biogenesis GO:0042254

                                           20                  40                  60                  80                 100
AA:                      MLRLRSGLRHLRATPNTRGSARLLCAEMPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAVNVAIAAPPSEGEAN
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................
DO_IUPRED2A:             ....DDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................DDDDDD........DDDDDD.......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
RICH_[AK]:                                   ArllcAempKKAgAttKgK                                                             
RICH_[K]:                                             KKagattKgKsqsK                                                         
RICH_[L]:                 LrLrsgLrhL                                                                                         
RICH_[R]:                  RlRsglRhlRatpntRgsaR                                                                              
RICH_[LR]:                LRLRsgLRhLRatpntR                                                                                  
RICH_MOBI_[AK]:                              ArllcAempKKAgAttKgK                                                             
RICH_MOBI_[K]:                                        KKagattKgKsqsK                                                         
RICH_MOBI_[L]:            LrLrsgLrhL                                                                                         
RICH_MOBI_[P]:                                                       PerPlPPlgP                                              
RICH_MOBI_[R]:             RlRsglRhlRatpntRgsaR                                                                              
RICH_MOBI_[LR]:           LRLRsgLRhLRatpntR                                                                                  

                                          120                 140       
AA:                      AELCRYLSKVLELRKSDVVLDKGGKSREKVVKLLASTTPEEILEKLKKEAKKT
STMI:                                                                         
DO_DISOPRED3:            ....................................................D
DO_IUPRED2A:             .................D...........DDD...........DDDDDD....
DO_SPOTD:                ..................................................DDD
CONSENSUS:               ....................................................D
CONSENSUS_MOBI:          .....................................................