Q86WX3 AROS_HUMAN

Gene name: RPS19BP1
Protein name: Active regulator of SIRT1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96CS4 ZNF689 0.80721 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 Q6DN03 H2BC20P 0.80475 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
3 Q6DRA6 H2BC19P 0.79928 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
4 Q8N6T7 SIRT6 0.77459 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
5 Q8N8Y5 ZFP41 0.7737 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
6 P17026 ZNF22 0.7648 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 P57053 H2BS1 0.76189 anatomical structure development GO:0048856
cellular component assembly GO:0022607
chromosome organization GO:0051276
...
8 O15213 WDR46 0.75931 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
9 O00479 HMGN4 0.75682
10 Q8N436 CPXM2 0.75522 cellular nitrogen compound metabolic process GO:0034641
protein maturation GO:0051604

                                           20                  40                  60                  80                 100
AA:                      MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRG
STMI:                                                                                                                        
DO_DISOPRED3:            D...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................
DO_IUPRED2A:             ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.......................DDDDDDDDDDDD
DO_SPOTD:                DDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................DDDD
CONSENSUS:               D..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................DDDD
CONSENSUS_MOBI:          ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................
RICH_[PR]:                                 PRdPPgqakPRgaPvkRPR                                                               
RICH_[AK]:                                        AKprgApvKrprKtKAiqA                                                        
RICH_[AP]:                            AAseAPrdPPgqAkPrgAP                                                                    
RICH_[K]:                                          KprgapvKrprKtKaiqaqKlrnsaKgK                                              
RICH_[P]:                                  PrdPPgqakPrgaPvkrP                                                                
RICH_[R]:                                   RdppgqakpRgapvkRpR                                                               
RICH_[KP]:                                    PPgqaKPrgaPvKrPrKtK                                                            
RICH_[KR]:                                           RgapvKRpRKtKaiqaqKlR                                                    
RICH_fLPS_[K]:                                                                                                           qnrg
RICH_MOBI_[PR]:                            PRdPPgqakPRgaPvkRPR                                                               
RICH_MOBI_[AK]:                                   AKprgApvKrprKtKAiqA                                                        
RICH_MOBI_[K]:                                     KprgapvKrprKtKaiqaqKlrnsaKgKvpK                                           
RICH_MOBI_[P]:                             PrdPPgqakPrgaPvkrP                                                                
RICH_MOBI_[R]:                              RdppgqakpRgapvkRpR                                                               
RICH_MOBI_[KR]:                                      RgapvKRpRKtKaiqaqKlR                                                    

                                          120    
AA:                      RKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
STMI:                                                        
DO_DISOPRED3:            ....D.......D.......................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDD..................
DO_SPOTD:                DDDDDDDDDDDDDDDDDD..................
CONSENSUS:               DDDDDDDDDDDDDDDDDD..................
CONSENSUS_MOBI:          ....................................
RICH_[K]:                 KacdrpvaKtKKKK                     
RICH_fLPS_[K]:           rKacdrpvaKtKKKKa