Q8WVJ2 NUDC2_HUMAN
Gene name: NUDCD2
Protein name: NudC domain-containing protein 2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q15743 | GPR68 | 0.80167 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 2 | P28070 | PSMB4 | 0.60644 | |
| 3 | O14522 | PTPRT | 0.56832 | cell adhesion GO:0007155 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 4 | Q9C075 | KRT23 | 0.55704 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 5 | Q9H773 | DCTPP1 | 0.51943 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q5VVQ6 | YOD1 | 0.51446 | catabolic process GO:0009056 cellular protein modification process GO:0006464 protein transport GO:0015031 ... |
| 7 | P48444 | ARCN1 | 0.47005 | anatomical structure development GO:0048856 developmental maturation GO:0021700 protein transport GO:0015031 ... |
| 8 | Q96BJ3 | AIDA | 0.46234 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 9 | Q5JUK2 | SOHLH1 | 0.44429 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 10 | Q9Y5S1 | TRPV2 | 0.43532 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
20 40 60 80 100 AA: MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCW STMI: DO_DISOPRED3: DDDDDDDD............................................................................................ DO_IUPRED2A: ........................................D........................................................... DO_SPOTD: DDDDDDDDDD.......................................................................................... CONSENSUS: DDDDDDDD............................................................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 AA: TSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK STMI: DO_DISOPRED3: ............................................DDDDDDDD.D..D DO_IUPRED2A: .......................................DD..........D...DD DO_SPOTD: ...........................................DDDDDD.D..D.DD CONSENSUS: ............................................DDDDDDDD.D.DD CONSENSUS_MOBI: .................................DDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[FG]: FdFsGaeisGnytkGGpdF