Q9H773 DCTP1_HUMAN
Gene name: DCTPP1
Protein name: dCTP pyrophosphatase 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- nucleobase-containing compound catabolic process GO:0034655
- response to stress GO:0006950
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5T319 | FAM182B | 0.65716 | |
| 2 | Q9C075 | KRT23 | 0.65376 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 3 | P57738 | TCTA | 0.61223 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 4 | O15552 | FFAR2 | 0.61187 | cell differentiation GO:0030154 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 5 | P47871 | GCGR | 0.60863 | carbohydrate metabolic process GO:0005975 circulatory system process GO:0003013 generation of precursor metabolites and energy GO:0006091 ... |
| 6 | P49840 | GSK3A | 0.60309 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 7 | Q96BZ9 | TBC1D20 | 0.60162 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 8 | P85299 | PRR5 | 0.59416 | cell cycle GO:0007049 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 9 | Q8WW01 | TSEN15 | 0.5927 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 10 | Q8N1Y9 | n/a | 0.592 |
20 40 60 80 100 AA: MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDD.............................................DD.DDDDDDDDDDDDDDDD.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... RICH_[G]: GGeirGdtGGedtaapG RICH_fLPS_[G]: GGeirGdtGG RICH_MOBI_[G]: GGeirGdtGGedtaapG RICH_MOBI_[FG]: GeirGdtGGedtaapGrFsF
120 140 160 AA: IYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST STMI: DO_DISOPRED3: ..............................................DDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...........................................D.DDDD..DD.DDDDDDDDDDDDDDDD DO_SPOTD: .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...........................................DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..............................................DDDDDDDDDDDDDDDDDDDDDDDD RICH_[DI]: IseDqavgpaDIpcD RICH_MOBI_[DI]: IseDqavgpaDIpcD