Q8WVJ9 TWST2_HUMAN

Gene name: TWIST2
Protein name: Twist-related protein 2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9ULG3 CFAP92 0.70593
2 Q01831 XPC 0.68513 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular component assembly GO:0022607
...
3 A8MTJ3 GNAT3 0.62754 nervous system process GO:0050877
protein folding GO:0006457
signal transduction GO:0007165
4 P35638 DDIT3 0.6167 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 A0A087WUL8 NBPF19 0.61353
6 P0DPF2 NBPF20 0.61327
7 Q9BZI7 UPF3B 0.60173 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
8 O15042 U2SURP 0.59814 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
9 Q13427 PPIG 0.59496 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
protein folding GO:0006457
10 Q7Z4V5 HDGFL2 0.59276 growth GO:0040007

                                           20                  40                  60                  80                 100
AA:                      MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDDDDDD.....................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...D..DDDDDDD.........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDD.........................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
RICH_[K]:                                          KrfgrKrrysKK                                                              
RICH_[R]:                                       RqpkRfgRkRR                                                                  
RICH_[S]:                    SSSpvSpvdSlgtS                                                                                  
RICH_[EK]:                                 EEElErqpKrfgrKrrysKK                                                              
RICH_[ER]:                                 EEElERqpkRfgRkRR                                                                  
RICH_[ES]:                EEgSSSpvSpvdSlgtSEEElE                                                                             
RICH_[GK]:                                                   KKssedGsptpGKrGKKG                                              
RICH_[KR]:                                      RqpKRfgRKRRysKK                                                              
RICH_MOBI_[K]:                                     KrfgrKrrysKK                                                              
RICH_MOBI_[R]:                                  RqpkRfgRkRR                                                                  
RICH_MOBI_[S]:               SSSpvSpvdSlgtS                                                                                  
RICH_MOBI_[SV]:              SSSpVSpVdS                                                                                      
RICH_MOBI_[EK]:                            EEElErqpKrfgrKrrysKK                                                              
RICH_MOBI_[ER]:                            EEElERqpkRfgRkRR                                                                  
RICH_MOBI_[ES]:           EEgSSSpvSpvdSlgtSEEElE                                                                             
RICH_MOBI_[GK]:                                              KKssedGsptpGKrGKKG                                              
RICH_MOBI_[KR]:                                 RqpKRfgRKRRysKK                                                              

                                          120                 140
AA:                      LSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
STMI:                                                                                
DO_DISOPRED3:            .......................................................DDDDD
DO_IUPRED2A:             ............................................................
DO_SPOTD:                ...........................DD.D.....................D.DDDDDD
CONSENSUS:               .......................................................DDDDD
CONSENSUS_MOBI:          ............................................................