Q8WW32 HMGB4_HUMAN
Gene name: HMGB4
Protein name: High mobility group protein B4
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NS28 | RGS18 | 0.76247 | signal transduction GO:0007165 |
| 2 | Q9HAC8 | UBTD1 | 0.73673 | |
| 3 | P48556 | PSMD8 | 0.71639 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | P12644 | BMP4 | 0.7079 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | P59020 | DSCR9 | 0.70538 | |
| 6 | Q9NVD3 | SETD4 | 0.70458 | cellular protein modification process GO:0006464 |
| 7 | O43812 | DUX1 | 0.69833 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q96PT4 | DUX3 | 0.68432 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | A8K010 | LINC00473 | 0.67581 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q99748 | NRTN | 0.67082 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
20 40 60 80 100 AA: MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQEPRRPPSSF STMI: DO_DISOPRED3: DDDDDDDDDDDDDD..................DD.DDD.....D........................................................ DO_IUPRED2A: DD.DD.......................................................................DDDDDDDDDDDDDDDDD....... DO_SPOTD: DDDDDDDDDD..........................................................DDDDDDDDDDDDDDDDDDDDDDDDDD...... CONSENSUS: DDDDDDDDDD..................................................................DDDDDDDDDDDDDDDDD....... CONSENSUS_MOBI: ............................................................................DDDDDDDDDDDDDDDDDDDDDD.. RICH_MOBI_[PR]: RdPqePRRPP RICH_MOBI_[R]: RkkRRkRdpqepRR RICH_MOBI_[KR]: KRKKRRKRdpqepRR RICH_fLPS_MOBI_[R]: kRkkRRkRdpqepRR
120 140 160 180 AA: LLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS STMI: DO_DISOPRED3: .........................................D.DDD..........D.....DDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..................................D...................................DD..DDDDDDDDDDDD DO_SPOTD: ..............................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..............................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...................................................................................... RICH_[R]: RkkyRmsaRnRcRgkRvR RICH_[CR]: CnaRkkyRmsaRnRCRgkR RICH_fLPS_[R]: naRkkyRmsaRnRcRgkRvR