Q8WWM9 CYGB_HUMAN
Gene name: CYGB
Protein name: Cytoglobin
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- response to stress GO:0006950
- small molecule metabolic process GO:0044281
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UHW5 | GPN3 | 0.66841 | |
| 2 | Q9UNK0 | STX8 | 0.66841 | immune system process GO:0002376 membrane organization GO:0061024 protein transport GO:0015031 ... |
| 3 | Q99418 | CYTH2 | 0.66245 | cytoskeleton organization GO:0007010 signal transduction GO:0007165 transport GO:0006810 ... |
| 4 | O15118 | NPC1 | 0.65122 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q9HCB6 | SPON1 | 0.63427 | cell adhesion GO:0007155 cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 |
| 6 | Q8TBC4 | UBA3 | 0.63285 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q8TEQ8 | PIGO | 0.62773 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 8 | Q9C0B1 | FTO | 0.62538 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q8TC92 | ENOX1 | 0.61678 | |
| 10 | Q9Y243 | AKT3 | 0.59784 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell population proliferation GO:0008283 ... |
20 40 60 80 100 AA: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPD STMI: DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDD...................................................D..D.......................... DO_SPOTD: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS_MOBI: DDD................................................................................................. RICH_[E]: EkvpgEmEiErrErsE RICH_[EM]: MEkvpgEMEiErrE RICH_[ER]: EmEiERRERsE
120 140 160 180 AA: KVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP STMI: DO_DISOPRED3: ............................................................................DDDDDDDDDDDDDD DO_IUPRED2A: ............................................................................DD.DDDDDDDDDDD DO_SPOTD: ........................................................................DDDDDDDDDDDDDDDDDD CONSENSUS: ............................................................................DDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................................................DD