Q8WY98 TM234_HUMAN
Gene name: TMEM234
Protein name: Transmembrane protein 234
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q15436 | SEC23A | 0.93888 | cellular component assembly GO:0022607 immune system process GO:0002376 membrane organization GO:0061024 ... |
| 2 | Q99062 | CSF3R | 0.83205 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 3 | Q9GZQ4 | NMUR2 | 0.79612 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 4 | Q9NP58 | ABCB6 | 0.78935 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | P35228 | NOS2 | 0.78633 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 6 | Q9NWZ3 | IRAK4 | 0.78488 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 7 | O00180 | KCNK1 | 0.74901 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 8 | P16473 | TSHR | 0.74126 | cell population proliferation GO:0008283 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 9 | Q92959 | SLCO2A1 | 0.71202 | transport GO:0006810 |
| 10 | Q9NWS0 | PIH1D1 | 0.70711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
20 40 60 80 100 AA: MAASLGQVLALVLVAALWGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGK STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDD.DDD............................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD................................................................................................. CONSENSUS: ............................................................ CONSENSUS_MOBI: ............................................................
120 140 160 AA: ALGEDIGGKRAVAGMVLTVIGISLCITSSVPWTAELQLHGKGQLQTLSQKCKREASGTQSERFG STMI: MM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .........................................DDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .............................................................DD. DO_SPOTD: ................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ......... .........DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ......... ................................ RICH_[Q]: QlQtlsQkckreasgtQ