Q8WYK2 JDP2_HUMAN

Gene name: JDP2
Protein name: Jun dimerization protein 2

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O95232 LUC7L3 0.76428 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
2 Q9UM54 MYO6 0.76058 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
3 Q6PH81 C16orf87 0.7551
4 P21127 CDK11B 0.75248 biosynthetic process GO:0009058
cell cycle GO:0007049
cell death GO:0008219
...
5 Q86WJ1 CHD1L 0.74623 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
6 Q9UQ88 CDK11A 0.71707 biosynthetic process GO:0009058
cell cycle GO:0007049
cell death GO:0008219
...
7 Q96CS3 FAF2 0.70909 catabolic process GO:0009056
immune system process GO:0002376
protein transport GO:0015031
...
8 Q8TDI8 TMC1 0.7047 anatomical structure development GO:0048856
cell differentiation GO:0030154
nervous system process GO:0050877
...
9 Q9BZI7 UPF3B 0.70373 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
10 Q96MF4 CCDC140 0.68804

                                           20                  40                  60                  80                 100
AA:                      MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
RICH_[AK]:                                                                                                   AAArcrnKKK      
RICH_[AN]:                                                                                                NkvAAArcrN         
RICH_[E]:                                                                     EvklgkrpqpvksEldEEEErrkrrrE                    
RICH_[K]:                                                                                KseldeeeerrKrrreKnKvaaarcrnKKK      
RICH_[L]:                               LpgLgpLtgLpssaLtveeL                                                                 
RICH_[R]:                                                                           RpqpvkseldeeeeRRkRRReknkvaaaRcRnkkkeR    
RICH_[T]:                           TTgslpglgplTglpssalT                                                                     
RICH_[EK]:                                                                               KsEldEEEErrKrrrEKnK                 
RICH_[ER]:                                                                          RpqpvksEldEEEERRkRRREknkvaaaRcR          
RICH_[GL]:                            GsLpGLGpLtGLpssaL                                                                      
RICH_[GP]:                 PGqiPdPsvttGslPGlGPltGlP                                                                          
RICH_[GT]:                          TTGslpGlGplTGlpssalT                                                                     
RICH_[KR]:                                                                               KseldeeeeRRKRRReKnK                 
RICH_[LP]:                     PdPsvttgsLPgLgPLtgLP                                                                          
RICH_[LT]:                          TTgsLpgLgpLTgLpssaLT                                                                     
RICH_fLPS_[R]:                                                                                eeeeRRkRRReknkvaaaRcR          
RICH_fLPS_[RE]:                                                                         vksEldEEEERRkRRREknkvaaaRcR          
RICH_fLPS_[E]:                                                                          vksEldEEEErrkrrrE                    
RICH_fLPS_[RK]:                                                                                eeeRRKRRReKnKvaaaRcRnKKKeR    
RICH_fLPS_[K]:                                                                                     rKrrreKnKvaaarcrnKKK      
RICH_MOBI_[E]:                                                                             EldEEEErrkrrrE                    
RICH_MOBI_[K]:                                                                           KseldeeeerrKrrreKnK                 
RICH_MOBI_[R]:                                                                      RpqpvkseldeeeeRRkRRReknkvaaaR            
RICH_MOBI_[EK]:                                                                          KsEldEEEErrKrrrEKnK                 
RICH_MOBI_[ER]:                                                                     RpqpvksEldEEEERRkRRREknkvaaaR            
RICH_MOBI_[GM]:          MMpGqipdpsvttGslpGlG                                                                                
RICH_MOBI_[KR]:                                                                          KseldeeeeRRKRRReKnK                 
RICH_fLPS_MOBI_[R]:                                                                           eeeeRRkRRReknkvaaaR            
RICH_fLPS_MOBI_[RE]:                                                                    vksEldEEEERRkRRRE                    
RICH_fLPS_MOBI_[E]:                                                                     vksEldEEEE                           

                                          120                 140                 160                 
AA:                      QRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK
STMI:                                                                                   
DO_DISOPRED3:            ............................................DDDDDDDDDDDDDDDD.DD
DO_IUPRED2A:             DDDDDDD..DD.DD..DD.....................DDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .......................................DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .......................................DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...............................................................
RICH_[EL]:                                                                  EgnpLLEqLE