Q8WYQ3 CHC10_HUMAN

Gene name: CHCHD10
Protein name: Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell junction organization GO:0034330
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- generation of precursor metabolites and energy GO:0006091
- membrane organization GO:0061024
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q99608 NDN 0.87714 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
2 P78357 CNTNAP1 0.86906 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
3 O00303 EIF3F 0.85878 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
4 Q96GE9 DMAC1 0.83588 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
5 Q8N6K4 n/a 0.82321
6 P12829 MYL4 0.81963 circulatory system process GO:0003013
7 Q96KE9 BTBD6 0.81934 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular protein modification process GO:0006464
8 P36957 DLST 0.8184 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
9 P40197 GP5 0.80492 cell adhesion GO:0007155
response to stress GO:0006950
10 P56270 MAZ 0.80224 biosynthetic process GO:0009058
cell death GO:0008219
cell population proliferation GO:0008283
...

                                           20                  40                  60                  80                 100
AA:                      MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMG
STMI:                    TTTTTTTTTTTTTTTT                                                                                    
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDDD.........
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS:                               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS_MOBI:                          DDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...
RICH_[PQ]:                                                                                              PsQPavQQaPtPaaPQPlQ  
RICH_[AH]:                               AApsAHppAHpppsAAApA                                                                 
RICH_[AP]:                               AAPsAhPPAhPPPsAAAPAPAPsgqPglmAqmA                              PsqPAvqqAPtPAAPqP    
RICH_[AQ]:                                                                                                QpAvQQAptpAApQplQ  
RICH_[A]:                                AApsAhppAhpppsAAApApApsgqpglmA                                     AvqqAptpAA       
RICH_[P]:                                  PsahPPahPPPsaaaPaPaPsgqP                                     PsqPavqqaPtPaaPqP    
RICH_[Q]:                                                                                                 QpavQQaptpaapQplQ  
RICH_[HP]:                                 PsaHPPaHPPPsaaaPaP                                                                
RICH_fLPS_[P]:                             PsahPPahPPPsaaaPaPaPsgqP                                                          
RICH_fLPS_[A]:                           AApsAhppAhpppsAAApApA                                                               
RICH_fLPS_[AP]:                          AAPsAhPPAhPPPsAAAPAPAP                                                              
RICH_MOBI_[PQ]:                                                                                         PsQPavQQaPtPaaPQP    
RICH_MOBI_[AH]:                          AApsAHppAHpppsAAApA                                                                 
RICH_MOBI_[AP]:                          AAPsAhPPAhPPPsAAAPAPAPsgqP                                     PsqPAvqqAPtPAAPqP    
RICH_MOBI_[AQ]:                                                                                           QpAvQQAptpAApQ     
RICH_MOBI_[A]:                           AApsAhppAhpppsAAApApA                                              AvqqAptpAA       
RICH_MOBI_[P]:                             PsahPPahPPPsaaaPaPaPsgqP                                     PsqPavqqaPtPaaPqP    
RICH_MOBI_[Q]:                                                                                            QpavQQaptpaapQ     
RICH_MOBI_[HP]:                            PsaHPPaHPPPsaaaPaP                                                                
RICH_fLPS_MOBI_[P]:                            PPahPPPsaaaPaPaPsgqP                                                          
RICH_fLPS_MOBI_[A]:                      AApsAhppAhpppsAAApApA                                                               
RICH_fLPS_MOBI_[AP]:                     AAPsAhPPAhPPPsAAAPAPAP                                                              

                                          120                 140                  
AA:                      PCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
STMI:                                                              
DO_DISOPRED3:            .........................................D
DO_IUPRED2A:             ..........................................
DO_SPOTD:                .....................................DDDDD
CONSENSUS:               .........................................D
CONSENSUS_MOBI:          ..........................................