Q96GE9 DMAC1_HUMAN

Gene name: DMAC1
Protein name: Distal membrane-arm assembly complex protein 1

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5TA89 HES5 0.9486 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
2 O00303 EIF3F 0.93275 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
3 Q53GA4 PHLDA2 0.9084 anatomical structure development GO:0048856
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...
4 Q5JR12 PPM1J 0.90335
5 P78357 CNTNAP1 0.88844 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
6 P63027 VAMP2 0.88022 cell-cell signaling GO:0007267
cellular component assembly GO:0022607
immune system process GO:0002376
...
7 Q8TF64 GIPC3 0.85678
8 Q8N6K4 n/a 0.85488
9 P12829 MYL4 0.8543 circulatory system process GO:0003013
10 P05976 MYL1 0.8542 circulatory system process GO:0003013

                                           20                  40                  60                  80                 100
AA:                      MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSENQGIATW
STMI:                                                                       MMMMMMMMMMMMMMMMMM            MMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................
DO_IUPRED2A:             ...................DDDDDDDDDDDDDDDDDDD..............................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........                  ............                   
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............                  ............                   
RICH_[AP]:                      PfesyitAPPgtAAAPAkPAPPAtPgAPtsPA                                                             
RICH_[A]:                              AppgtAAApAkpAppAtpgAptspA                                                             
RICH_[P]:                               PPgtaaaPakPaPPatPgaPtsP                                                              
RICH_fLPS_[P]:                          PPgtaaaPakPaPPatPgaP                                                                 
RICH_fLPS_[A]:                         AppgtAAApAkpAppAtpgAptspA                                                             
RICH_fLPS_[AP]:                        APPgtAAAPAkPAPPAtPgAPtsPA                                                             
RICH_MOBI_[AP]:                        APPgtAAAPAkPAPPAtPgAPtsPA                                                             
RICH_MOBI_[A]:                         AppgtAAApAkpAppAtpgAptspA                                                             
RICH_MOBI_[P]:                          PPgtaaaPakPaPPatPgaPtsP                                                              
RICH_fLPS_MOBI_[A]:                    AppgtAAApAkpAppAtpgAptspA                                                             

                             
AA:                      GIVVMADPKGKAYRVV
STMI:                    MMMM            
DO_DISOPRED3:            ............DDDD
DO_IUPRED2A:             ................
DO_SPOTD:                ................
CONSENSUS:                   ............
CONSENSUS_MOBI:              ............