Q92686 NEUG_HUMAN

Gene name: NRGN
Protein name: Neurogranin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell-cell signaling GO:0007267
- nervous system process GO:0050877
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q16763 UBE2S 0.68408 catabolic process GO:0009056
cell cycle GO:0007049
cell division GO:0051301
...
2 Q9UPR0 PLCL2 0.68397 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
3 Q9P291 ARMCX1 0.6657
4 Q15050 RRS1 0.66525 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
5 P48382 RFX5 0.64916 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 Q9NUD5 ZCCHC3 0.64575 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
7 Q9Y237 PIN4 0.64103 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
8 P28329 CHAT 0.6376 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
transport GO:0006810
9 O43818 RRP9 0.62869 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
10 Q6IBS0 TWF2 0.626 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...

                                           20                  40                  60  
AA:                      MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
STMI:                                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDD..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ....D........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AD]:                           DDDilDiplDDpgAnAAAA                                               
RICH_[AG]:                                                                            GGAGvArGGAGG     
RICH_[AI]:                                 IplddpgAnAAAAkI                                             
RICH_[AK]:                                          AAAAKiqAsfrghmArKKiK                               
RICH_[A]:                                         AnAAAAkiqAsfrghmA                                    
RICH_[D]:                 DcctenacskpDDDilDiplDD                                                       
RICH_[G]:                                                                GerGrkGpGpGGpGGaGvarGGaGGGpsG 
RICH_[K]:                                               KiqasfrghmarKKiK                               
RICH_[R]:                                                     RghmaRkkiksgeRgR                         
RICH_[CD]:                DCCtenaCskpDDDilDiplDD                                                       
RICH_[DI]:                           DDDIlDIplDD                                                       
RICH_[GK]:                                                     GhmarKKiKsGerGrKGpGpGGpGG               
RICH_[GP]:                                                                      PGPGGPGGaGvarGGaGGGP   
RICH_[GR]:                                                    RGhmaRkkiksGeRGRkGpG                     
RICH_[KR]:                                                    RghmaRKKiKsgeRgRK                        
RICH_fLPS_[A]:                                 dpgAnAAAAkiqAsfrghmA                                    
RICH_fLPS_[C]:           mdCCtenaCskpddd                                                               
RICH_fLPS_[D]:            DcctenacskpDDDilDiplDD                                                       
RICH_fLPS_[G]:                                                           GerGrkGpGpGGpGGaGvarGGaGGGpsG 
RICH_fLPS_[DA]:                      DDDilDiplDDpgAnAAAA                                               
RICH_fLPS_[DC]:          mDCCtenaCskpDDDilDiplDD                                                       
RICH_MOBI_[AG]:                                                                       GGAGvArGGAGG     
RICH_MOBI_[AI]:                                     AAAAkIqAsfrghmArkkI                                
RICH_MOBI_[AK]:                                     AAAAKiqAsfrghmArKKiK                               
RICH_MOBI_[A]:                                    AnAAAAkiqAsfrghmA                                    
RICH_MOBI_[G]:                                                           GerGrkGpGpGGpGGaGvarGGaGGGpsG 
RICH_MOBI_[K]:                                          KiqasfrghmarKKiK                               
RICH_MOBI_[R]:                                                RghmaRkkiksgeRgR                         
RICH_MOBI_[GK]:                                                GhmarKKiKsGerGrKGpGpGGpGG               
RICH_MOBI_[GR]:                                               RGhmaRkkiksGeRGRkGpG                     
RICH_MOBI_[IK]:                                         KIqasfrghmarKKIK                               
RICH_MOBI_[KR]:                                               RghmaRKKiKsgeRgRK                        
RICH_fLPS_MOBI_[A]:                               AnAAAAkiqAsfrghmArkk                                 
RICH_fLPS_MOBI_[G]:                                                      GerGrkGpGpGGpGGaGvarGGaGGGpsG