Q9Y237 PIN4_HUMAN
Gene name: PIN4
Protein name: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- ribosome biogenesis GO:0042254
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q16763 | UBE2S | 0.7954 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 2 | Q6IBS0 | TWF2 | 0.7746 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 3 | Q70UQ0 | IKBIP | 0.77216 | |
| 4 | Q53HC5 | KLHL26 | 0.7541 | |
| 5 | P16455 | MGMT | 0.73615 | cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 6 | P23582 | NPPC | 0.73027 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 7 | Q9BYN0 | SRXN1 | 0.72753 | response to stress GO:0006950 |
| 8 | Q10471 | GALNT2 | 0.72592 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 immune system process GO:0002376 |
| 9 | Q5JPI9 | EEF1AKMT2 | 0.72169 | cellular protein modification process GO:0006464 |
| 10 | Q9Y5F8 | PCDHGB7 | 0.72062 | cell adhesion GO:0007155 |
20 40 60 80 100 AA: MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............D............DDDDD.D..DDD.DDDDDDD............ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... RICH_[AG]: GksGsGkAGkGGAAsGsdsAdkkAqGpkGGG RICH_[AK]: KAgKggAAsgsdsAdKKA RICH_[G]: GksGsGkaGkGGaasG RICH_[K]: KgKsgsgKagK RICH_[GK]: KGKsGsGKaGKGGaasG KKaqGpKGGG RICH_fLPS_[G]: mppkGksGsGkaGkGGaasG RICH_MOBI_[AG]: GksGsGkAGkGGAAsGsdsA RICH_MOBI_[AK]: KAgKggAAsgsdsAdKK RICH_MOBI_[G]: GksGsGkaGkGGaasG RICH_MOBI_[K]: KgKsgsgKagK RICH_MOBI_[GK]: KGKsGsGKaGKGGaasG RICH_fLPS_MOBI_[G]: mppkGksGsGkaGkGGaasG
120 AA: LPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK STMI: DO_DISOPRED3: ..............................D DO_IUPRED2A: ....D.......................... DO_SPOTD: ..............................D CONSENSUS: ..............................D CONSENSUS_MOBI: ...............................