A6NIN4 RN227_HUMAN
Gene name: RNF227
Protein name: RING finger protein 227
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | P40337 | VHL | 0.92042 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
2 | P55822 | SH3BGR | 0.87977 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
3 | Q969H6 | POP5 | 0.86643 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
4 | Q8N239 | KLHL34 | 0.86492 | |
5 | P68371 | TUBB4B | 0.85465 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
6 | Q2M329 | CCDC96 | 0.84747 | |
7 | Q13105 | ZBTB17 | 0.83783 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
8 | Q86TD4 | SRL | 0.8289 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
9 | P10645 | CHGA | 0.82723 | cell death GO:0008219 cell-cell signaling GO:0007267 circulatory system process GO:0003013 ... |
10 | P48544 | KCNJ5 | 0.82393 | cell-cell signaling GO:0007267 circulatory system process GO:0003013 transmembrane transport GO:0055085 ... |
20 40 60 80 100 AA: MQLLVRVPSLPERGELDCNICYRPFNLGCRAPRRLPGTARARCGHTICTACLRELAARGDGGGAAARVVRLRRVVTCPFCRAPSQLPRGGLTEMALDSDL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDD................................................DD...................................... CONSENSUS: DDDDDDDDDDDD........................................................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: WSRLEEKARAKCERDEAGNPAKESSDADGEAEEEGESEKGAGPRSAGWRALRRLWDRVLGPARRWRRPLPSNVLYCAEIKDIGHLTRCTL STMI: DO_DISOPRED3: .........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................... DO_IUPRED2A: ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. DO_SPOTD: .........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................DDDD CONSENSUS: .........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. CONSENSUS_MOBI: ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................. RICH_[AE]: ErdEAgnpAkEssdAdgEAEEEgE RICH_[E]: EagnpakEssdadgEaEEEgEsE RICH_[EG]: EssdadGEaEEEGEsEkGaG RICH_fLPS_[E]: EagnpakEssdadgEaEEEgEsE RICH_MOBI_[AE]: ErdEAgnpAkEssdAdgEAEEEgE RICH_MOBI_[E]: EagnpakEssdadgEaEEEgEsE RICH_MOBI_[EG]: EssdadGEaEEEGEsEkGaG RICH_fLPS_MOBI_[E]: EssdadgEaEEEgEsE