Q969T4 UB2E3_HUMAN

Gene name: UBE2E3
Protein name: Ubiquitin-conjugating enzyme E2 E3

List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
- growth GO:0040007

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q14BN4 SLMAP 0.64018 homeostatic process GO:0042592
transmembrane transport GO:0055085
transport GO:0006810
2 Q9H8M9 EVA1A 0.6219 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
3 Q8N157 AHI1 0.62057 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
4 Q92541 RTF1 0.61031 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
5 P38432 COIL 0.60471 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
6 Q96LR5 UBE2E2 0.59505 cell cycle GO:0007049
cellular protein modification process GO:0006464
mitotic cell cycle GO:0000278
...
7 Q6PI26 SHQ1 0.59357 cell death GO:0008219
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
8 P45984 MAPK9 0.59207 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
9 Q9UPQ0 LIMCH1 0.59164 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
...
10 Q92870 APBB2 0.59112 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...

                                           20                  40                  60                  80                 100
AA:                      MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D.....DDDDDDDDDDDDDDD.DDDD....DDD......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
RICH_[D]:                   DrqrsDDespstssgssDaDqrD                                                                          
RICH_[K]:                                                      KpsatqqKKntKlssKttaK                                          
RICH_[S]:                 SSdrqrSddeSpStSSgSS                                                                                
RICH_[T]:                                                          TqqkknTklsskTT                                            
RICH_[DS]:                SSDrqrSDDeSpStSSgSSDaDqrD                                                                          
RICH_[EK]:                                             EpEEqEErKpsatqqKKntK                                                  
RICH_[EP]:                                         PaaPEPEEqEErkP                                                            
RICH_[EQ]:                                             EpEEQEErkpsatQQ                                                       
RICH_[KT]:                                                     KpsaTqqKKnTKlssKTTaK                                          
RICH_fLPS_[S]:           mSSdrqrSddeSpStSSgSS                                                                                
RICH_fLPS_[E]:                                      aapEpEEqEE                                                               
RICH_MOBI_[D]:              DrqrsDDespstssgssDaDqrD                                                                          
RICH_MOBI_[K]:                                                 KpsatqqKKntKlssKttaK                                          
RICH_MOBI_[S]:            SSdrqrSddeSpStSSgSS                                                                                
RICH_MOBI_[T]:                                                     TqqkknTklsskTTaklsT                                       
RICH_MOBI_[DS]:           SSDrqrSDDeSpStSSgSSDaDqrD                                                                          
RICH_MOBI_[EK]:                                        EpEEqEErKpsatqqKKntK                                                  
RICH_MOBI_[EQ]:                                        EpEEQEErkpsatQQ                                                       
RICH_MOBI_[KT]:                                                KpsaTqqKKnTKlssKTTaKlsT                                       
RICH_fLPS_MOBI_[S]:      mSSdrqrSddeSpStSSgSS                                                                                
RICH_fLPS_MOBI_[E]:                                 aapEpEEqEE                                                               

                                          120                 140                 160                 180                 200
AA:                      PGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQ
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                      
AA:                      WTKRYAT
STMI:                           
DO_DISOPRED3:            .......
DO_IUPRED2A:             .......
DO_SPOTD:                .......
CONSENSUS:               .......
CONSENSUS_MOBI:          .......