Q96A00 PP14A_HUMAN

Gene name: PPP1R14A
Protein name: Protein phosphatase 1 regulatory subunit 14A

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q86SX3 TEDC1 0.8588 signal transduction GO:0007165
2 A4D2B8 PMS2P1 0.82157 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
3 A8MQB3 LINC02693 0.81157
4 O95922 TTLL1 0.78539 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
5 A1L168 C20orf202 0.77778
6 Q8IYR6 TMEFF1 0.77162 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
7 Q96PD7 DGAT2 0.76461 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
8 P43116 PTGER2 0.76241 cell population proliferation GO:0008283
circulatory system process GO:0003013
homeostatic process GO:0042592
...
9 Q9Y5X5 NPFFR2 0.75488 cellular protein modification process GO:0006464
signal transduction GO:0007165
10 Q86YD1 PTOV1 0.74853 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSRKIQGLLKSC
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................
DO_IUPRED2A:             ...........DDDDDDDDDDDDDDDDDDDDDDDDDD............................DDDD.....DDDDDDDD.........DDDDD....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................................
RICH_[R]:                    RlgkRvlsklqspsRaR                                                                               
RICH_fLPS_[G]:                              arGpGGspGG                                                                       
RICH_MOBI_[R]:               RlgkRvlsklqspsRaR                                                                               
RICH_MOBI_[GR]:                            RaRGpGGspGGlqkRhaR                                                                
RICH_fLPS_MOBI_[G]:                         arGpGGspGG                                                                       

                                          120                 140             
AA:                      GKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQDRARTAHP
STMI:                                                                   
DO_DISOPRED3:            .......................DDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ....................DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ....................DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD