Q96A22 CK052_HUMAN

Gene name: C11orf52
Protein name: Uncharacterized protein C11orf52

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9P2G9 KLHL8 0.80897 catabolic process GO:0009056
cellular protein modification process GO:0006464
2 P58215 LOXL3 0.76203 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
3 Q96JA4 MS4A14 0.74356
4 Q9H583 HEATR1 0.73077 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
5 Q9UKG4 SLC13A4 0.72183 transmembrane transport GO:0055085
transport GO:0006810
6 Q9H853 TUBA4B 0.72138 cell cycle GO:0007049
cytoskeleton organization GO:0007010
mitotic cell cycle GO:0000278
7 Q9BVW6 SMIM2 0.71941
8 Q6P3W7 SCYL2 0.70341 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
signal transduction GO:0007165
...
9 P48729 CSNK1A1 0.70327 anatomical structure development GO:0048856
catabolic process GO:0009056
cell cycle GO:0007049
...
10 P13196 ALAS1 0.70079 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MGNRVCCGGSWSCPSTFQKKKKTGSQTRRTLKPQPQQLQQNLPKGHETTGHTYERVLQQQGSQERSPGLMSEDSNLHYADIQVCSRPHAREVKHVHLENA
STMI:                                                                                                                        
DO_DISOPRED3:            D...................DDDDDDDDDDDDDDDDDDDDDDDDD.......................................................
DO_IUPRED2A:             .................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...D..DDDDD....DDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDD...........................
CONSENSUS:               D................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
CONSENSUS_MOBI:          ................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
RICH_[K]:                                  KKKKtgsqtrrtlK                                                                    
RICH_[Q]:                                 QkkkktgsQtrrtlkpQpQQlQQ                                                            
RICH_[HQ]:                                                   QlQQnlpkgHettgH                                                 
RICH_[KQ]:                                QKKKKtgsQtrrtlKpQpQQlQ                                                             
RICH_fLPS_[Q]:                            QkkkktgsQtrrtlkpQpQQlQQ                                                            
RICH_MOBI_[K]:                             KKKKtgsqtrrtlK                                                                    
RICH_MOBI_[Q]:                            QkkkktgsQtrrtlkpQpQQlQQ                                                            
RICH_MOBI_[HQ]:                                              QlQQnlpkgHettgH                                                 
RICH_MOBI_[KQ]:                           QKKKKtgsQtrrtlKpQpQQlQ                                                             
RICH_MOBI_[LQ]:                                        LkpQpQQLQQnL                                                          
RICH_fLPS_MOBI_[Q]:                       QkkkktgsQtrrtlkpQpQQlQQ                                                            

                                          120                 
AA:                      TEYATLRFPQATPRYDSKNGTLV
STMI:                                           
DO_DISOPRED3:            .......................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .......................
CONSENSUS:               .......................
CONSENSUS_MOBI:          .......................