List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q9H853	TUBA4B	0.99563	cell cycle GO:0007049 cytoskeleton organization GO:0007010 mitotic cell cycle GO:0000278
2	Q4U2R8	SLC22A6	0.87581	transport GO:0006810
3	P49901	SMCP	0.86813	reproduction GO:0000003
4	Q96JA4	MS4A14	0.85329
5	Q9BVH7	ST6GALNAC5	0.80859	biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular nitrogen compound metabolic process GO:0034641 ...
6	Q9ULV3	CIZ1	0.80669
7	O75208	COQ9	0.78647	biosynthetic process GO:0009058 generation of precursor metabolites and energy GO:0006091 small molecule metabolic process GO:0044281
8	P0DMB2	C8orf88	0.76956	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412
9	Q96SR6	ZNF382	0.76956	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
10	Q92753	RORB	0.76652	anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ...

                                           20                  40                  60                  80               
AA:                      MEAGERIDASQLPHRVLETRGHAISILFGFWTSFICDTYIVLAWISKIKGSPDVSASSDEPYARIQQSRRQCHAEEDQSQVPEAG
STMI:                                        MMMMMMMMMMMMMMMMMMMMMMM                                          
DO_DISOPRED3:            DDDDDD......................................................DDDDD.DDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             D.DDD......D............................................DDDDDD..DDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDD....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDD.....D........                       .............DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................                       .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[Q]:                                                                                 QQsrrQchaeedQsQ     
RICH_fLPS_[Q]:                                                                            QQsrrQchaeedQsQ     
RICH_MOBI_[Q]:                                                                            QQsrrQchaeedQsQ     
RICH_fLPS_MOBI_[Q]:                                                                       QQsrrQchaeedQsQ