Q96AQ7 CIDEC_HUMAN
Gene name: CIDEC
Protein name: Cell death activator CIDE-3
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q16706 | MAN2A1 | 0.68947 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 2 | Q9H159 | CDH19 | 0.68474 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 3 | Q9Y294 | ASF1A | 0.64635 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 4 | Q6P9F7 | LRRC8B | 0.62948 | response to stress GO:0006950 transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | P51582 | P2RY4 | 0.57953 | cell-cell signaling GO:0007267 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
| 6 | Q9ULS6 | KCNS2 | 0.56193 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ... |
| 7 | Q14849 | STARD3 | 0.55631 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 transport GO:0006810 ... |
| 8 | Q9NYB5 | SLCO1C1 | 0.50658 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 9 | Q8IYF3 | TEX11 | 0.50567 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 10 | Q96SZ6 | CDK5RAP1 | 0.49842 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: ..............................DDDDDDDDDDDDDDDDD..................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[S]: SlSllypkSlSrhvSvrtS RICH_[Y]: YamkslsllY RICH_[LS]: SLSLLypkSLSrhvSvrtS RICH_[LV]: LsLLypksLsrhVsVrtsVV RICH_[LY]: YamksLsLLYpksL RICH_fLPS_[V]: rhVsVrtsVV
120 140 160 180 200 AA: LAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGH STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................DDDDDDDDDDDD....................................................................... DO_SPOTD: .......................DD...D.D..................................................................... CONSENSUS: .......................DDDDDD....................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: VLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ STMI: DO_DISOPRED3: ...............DDDDDDDDDDDDDD..D...... DO_IUPRED2A: ...................................... DO_SPOTD: ................DDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ................DDDDDDDDDDDDDDDD...... CONSENSUS_MOBI: ......................................