Q96AZ1 EFMT3_HUMAN
Gene name: EEF1AKMT3
Protein name: EEF1A lysine methyltransferase 3
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P56180 | TPTE | 0.83385 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 2 | Q9Y5E3 | PCDHB6 | 0.74138 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 3 | Q12908 | SLC10A2 | 0.72833 | transport GO:0006810 |
| 4 | Q53GT1 | KLHL22 | 0.56697 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 5 | P31350 | RRM2 | 0.56505 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 6 | Q6XPS3 | TPTE2 | 0.50206 | biosynthetic process GO:0009058 |
| 7 | Q3MJ16 | PLA2G4E | 0.49988 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 transport GO:0006810 ... |
| 8 | C9J202 | ALG1L2 | 0.49338 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 9 | P35219 | CA8 | 0.49128 | signal transduction GO:0007165 small molecule metabolic process GO:0044281 |
| 10 | Q96BJ3 | AIDA | 0.48803 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDD...................................................................................... DO_SPOTD: DDDDDDDDDDDDDD...................................................................................... CONSENSUS: DDDDDDDDDDDDDD...................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. RICH_MOBI_[EF]: EsEsEsvFprEvglF
120 140 160 180 200 AA: TITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHF STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: QLELAQRDEDENVNIYRARHREPRPA STMI: DO_DISOPRED3: ......................DDDD DO_IUPRED2A: ............DDDDDDDDD..D.D DO_SPOTD: ......................DDDD CONSENSUS: ......................DDDD CONSENSUS_MOBI: ..........................