C9J202 AG1L2_HUMAN
Gene name: ALG1L2
Protein name: Putative glycosyltransferase ALG1L2
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96IC2 | REXO5 | 0.65266 | |
| 2 | Q8TBR5 | CIRBP-AS1 | 0.62292 | |
| 3 | B2RBV5 | n/a | 0.59343 | cell cycle GO:0007049 |
| 4 | Q8IXT5 | RBM12B | 0.58563 | cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q5RGS3 | FAM74A1 | 0.58357 | |
| 6 | Q9NZY2 | FAM30A | 0.56944 | |
| 7 | Q13573 | SNW1 | 0.55879 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 8 | Q15049 | MLC1 | 0.55218 | protein transport GO:0015031 response to stress GO:0006950 transport GO:0006810 ... |
| 9 | O43709 | BUD23 | 0.5474 | cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ribosome biogenesis GO:0042254 |
| 10 | Q96AJ9 | VTI1A | 0.54731 | catabolic process GO:0009056 membrane organization GO:0061024 protein targeting GO:0006605 ... |
20 40 60 80 100 AA: MGATAGWAVTVYDKPASFFKEAPLDLQHRLFMKLGSTHSPFRARSEPEDPDTERSAFTERDSGSGLVTRLHERPALLVSSTSWTEFEQLTLDGQNLPSLV STMI: DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: ........................................DDDDDDDDDDDDDDDDDDDD........................................ DO_SPOTD: DDDD......................................DDDDDDDDDDD............................................... CONSENSUS: DDD.......................................DDDDDDDDDDD............................................... CONSENSUS_MOBI: .......................................DDDDDDDDDDDDDDDDDDDDDDDDDDD.................................. RICH_MOBI_[R]: RaRsepedpdteRsafteR RICH_MOBI_[EF]: FrarsEpEdpdtErsaFtE RICH_MOBI_[ER]: RaRsEpEdpdtERsaftER RICH_MOBI_[FR]: FRaRsepedpdteRsaFteR
120 140 160 180 200 AA: CVITGKGPLREYYSRLIHQKHFQHIQVCIPWLEGRGLPPLLGSVDLDVCLDTSSSGLDLPMKVVDMFRCCLPACAVNFKCLHELVKHEENRLVFEDSEEL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: AAQLQYFADAFLKLS STMI: DO_DISOPRED3: ............... DO_IUPRED2A: ............... DO_SPOTD: ..............D CONSENSUS: ............... CONSENSUS_MOBI: ...............