Q96D05 F241B_HUMAN

Gene name: FAM241B
Protein name: Protein FAM241B

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NX00 TMEM160 0.63962
2 Q86SH2 ZAR1 0.61932 anatomical structure development GO:0048856
3 Q9H6R0 DHX33 0.61401 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
4 A6NLF2 ELOA3DP 0.61164 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q9NY12 GAR1 0.60628 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
6 Q8NG57 ELOA3P 0.6055 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 Q3SY89 ELOA3BP 0.60372 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 P46783 RPS10 0.60276 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 Q9NQ39 RPS10P5 0.59953 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
ribonucleoprotein complex assembly GO:0022618
...
10 Q96NA8 TSNARE1 0.59782 membrane organization GO:0061024
protein transport GO:0015031
transport GO:0006810
...

                                           20                  40                  60                  80                 100
AA:                      MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMM
STMI:                                                                                                               MMMMMMMMM
DO_DISOPRED3:            ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................
DO_IUPRED2A:             ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................DDDDDDDDDDDDDDDD
CONSENSUS:               ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................         
CONSENSUS_MOBI:          ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................         
RICH_[PR]:                              PRvRtttqPPRgsiPR                                                                     
RICH_[AG]:                                                      GAppGGpGprqqqAGArlGAA                                        
RICH_[AP]:                                                       APPggPgPrqqqAgArlgAA                                        
RICH_[AQ]:                                                                QQQAgArlgA                                         
RICH_[RT]:                               RvRTTTqppR                                                                          
RICH_[G]:                                                     GhGappGGpGprqqqaGarlG                                          
RICH_[R]:                                RvRtttqppRgsipRqsffnR                                                               
RICH_[DT]:                           DDDprvrTTT                                                                              
RICH_[FG]:                                                FFnrGhGappGGpG                                                     
RICH_[GP]:                                       PrGsiPrqsffnrGhGaPPG                                                        
RICH_[GQ]:                                                    GhGappGGpGprQQQaG                                              
RICH_fLPS_[G]:                                                GhGappGGpG                                                     
RICH_MOBI_[RT]:                          RvRTTTqppR                                                                          
RICH_MOBI_[G]:                                                GhGappGGpGprqqqaGarlG                                          
RICH_MOBI_[R]:                           RvRtttqppRgsipRqsffnR                                                               
RICH_MOBI_[DT]:                      DDDprvrTTT                                                                              
RICH_MOBI_[FG]:                                    GsiprqsFFnrGhGappGGpG                                                     
RICH_MOBI_[FR]:                          RvRtttqppRgsipRqsFFnR                                                               
RICH_MOBI_[GQ]:                                               GhGappGGpGprQQQaG                                              

                                          120                   
AA:                      LGVRGLLLVGLVYLVSHLSQR
STMI:                    MMMMMMMMMMMM         
DO_DISOPRED3:            ....................D
DO_IUPRED2A:             .....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                           ........D
CONSENSUS_MOBI:                      .........