Q9NX00 TM160_HUMAN
Gene name: TMEM160
Protein name: Transmembrane protein 160
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q69YL0 | NCBP2AS2 | 0.84636 | |
| 2 | P26006 | ITGA3 | 0.8301 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 3 | Q8N910 | C15orf56 | 0.82898 | |
| 4 | Q86X59 | LINC02875 | 0.81658 | |
| 5 | Q9BX95 | SGPP1 | 0.80779 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 6 | O15553 | MEFV | 0.80043 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 7 | Q5VUJ9 | EFCAB2 | 0.78506 | |
| 8 | B2RXF0 | TMEM229A | 0.78437 | |
| 9 | O15232 | MATN3 | 0.77974 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 10 | B3EWF7 | EPM2A | 0.77941 | catabolic process GO:0009056 signal transduction GO:0007165 |
20 40 60 80 100 AA: MGGGWWWARAARLARLRFRRSLLPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADAWLLRKAHETAFLSWFRNGLLASGIGVISFMQSDMGREAAY STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDD....................DDDDDDDDDDDDDDDDDDDDDDD...................................................... DO_IUPRED2A: ............................DDDDDDDDDDDDDDDDDDDDDD.................................................. DO_SPOTD: DDDDDD.DDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. CONSENSUS: DDD....................DDDDDDDDDDDDDDDDDDDDDDDDDDD................... .......... CONSENSUS_MOBI: .......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD................. .......... RICH_[PR]: PqRPRsggaRgsfaPghgPR RICH_[AG]: GGArGsfApGhGprAGA RICH_[AP]: ArgsfAPghgPrAgAsPP RICH_[G]: GGarGsfapGhGpraG RICH_[R]: RpRsggaRgsfapghgpR RICH_[GP]: PPqrPrsGGarGsfaPGhGP RICH_[GR]: RpRsGGaRGsfapGhGpRaG RICH_MOBI_[AG]: GGArGsfApGhGprAGA RICH_MOBI_[G]: GGarGsfapGhGpraG RICH_MOBI_[R]: RpRsggaRgsfapghgpR RICH_MOBI_[GR]: RpRsGGaRGsfapGhGpRaG
120 140 160 180 AA: GFFLLGGLCVVWGSASYAVGLAALRGPMQLTLGGAAVGAGAVLAASLLWACAVGLYMGQLELDVELVPEDDGTASAEGPDEAGRPPPE STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .....................................................................DDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .....................................................................DDDDDDDDDDDDDDDDDDD DO_SPOTD: ....................................................................DDDDDDDDDDDDDDDDDDDD CONSENSUS: . ............ ..............DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: . ............ ............DDDDDDDDDDDDDDDDDDDDD