Q9BSM1 PCGF1_HUMAN
Gene name: PCGF1
Protein name: Polycomb group RING finger protein 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | P62280 | RPS11 | 0.99941 |
biological process involved in symbiotic interaction
GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
2 | Q8N8J6 | ZNF615 | 0.85749 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
3 | Q96G30 | MRAP2 | 0.70711 |
generation of precursor metabolites and energy
GO:0006091 homeostatic process GO:0042592 signal transduction GO:0007165 |
4 | Q9UK13 | ZNF221 | 0.70711 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
5 | A8MTZ0 | BBIP1 | 0.6872 |
cellular component assembly
GO:0022607 protein transport GO:0015031 transport GO:0006810 |
6 | Q15436 | SEC23A | 0.66389 |
cellular component assembly
GO:0022607 immune system process GO:0002376 membrane organization GO:0061024 ... |
7 | Q9Y5C1 | ANGPTL3 | 0.65673 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 carbohydrate metabolic process GO:0005975 ... |
8 | Q96MR6 | CFAP57 | 0.65072 | |
9 | Q13163 | MAP2K5 | 0.64378 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
10 | Q8WYA0 | IFT81 | 0.63734 |
cellular component assembly
GO:0022607 cytoskeleton-dependent intracellular transport GO:0030705 protein transport GO:0015031 ... |
20 40 60 80 100
AA: MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKL
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD...........................................................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD...........................................................................
CONSENSUS_MOBI: ....................................................................................................
RICH_[Q]: QggQiaiamrlrnQlQ
RICH_[IQ]: QggQIaIamrlrnQlQ
120 140 160 180 200
AA: DRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEV
STMI:
DO_DISOPRED3: ...................................DDDDDDDDDDDDDDDDDDDDDDD..........................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................
CONSENSUS: ...................................DDDDDDDDDDDDDDDDDDDDDDD..........................................
CONSENSUS_MOBI: .................................................DDDDDDD.....................DDDDDDD................
220 240
AA: RHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
STMI:
DO_DISOPRED3: ........................................................DDD
DO_IUPRED2A: ...........................................................
DO_SPOTD: ........................................................DDD
CONSENSUS: ........................................................DDD
CONSENSUS_MOBI: ...........................................................