Q96HR3 MED30_HUMAN
Gene name: MED30
Protein name: Mediator of RNA polymerase II transcription subunit 30
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96G91 | P2RY11 | 0.74574 | response to stress GO:0006950 signal transduction GO:0007165 |
| 2 | Q9Y345 | SLC6A5 | 0.68424 | cell-cell signaling GO:0007267 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | Q01581 | HMGCS1 | 0.67983 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q96A09 | TENT5B | 0.67243 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 nucleobase-containing compound catabolic process GO:0034655 |
| 5 | O95182 | NDUFA7 | 0.64967 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | P25098 | GRK2 | 0.6494 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell-cell signaling GO:0007267 ... |
| 7 | Q8N884 | CGAS | 0.63792 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell-cell signaling GO:0007267 ... |
| 8 | Q3LXA3 | TKFC | 0.63693 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 immune system process GO:0002376 ... |
| 9 | Q9NQT5 | EXOSC3 | 0.63542 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | P48067 | SLC6A9 | 0.62234 | cell-cell signaling GO:0007267 circulatory system process GO:0003013 transport GO:0006810 |
20 40 60 80 100 AA: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCN STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_IUPRED2A: D.DDDDDDDDDDDDD.DDDDDDD..........................................DD...D............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. RICH_[AP]: PPlAAsgmAPgPfAgPqAqqA RICH_[AQ]: ApgpfAgpQAQQAA RICH_[A]: AAsgmApgpfAgpqAqqAA RICH_MOBI_[AM]: MstpplAAsgMApgpfA RICH_MOBI_[A]: AAsgmApgpfAgpqA
120 140 160 AA: ENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN STMI: DO_DISOPRED3: .............................................................................. DO_IUPRED2A: ................DD.DDDDDDDDDDDDDDDDDDD.DD...DDDD.............................. DO_SPOTD: ....................DDDDDDDDDDD............................................... CONSENSUS: ....................DDDDDDDDDDD............................................... CONSENSUS_MOBI: ..............................................................................