Q9NQT5 EXOS3_HUMAN
Gene name: EXOSC3
Protein name: Exosome complex component RRP40
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- immune system process GO:0002376
- nucleobase-containing compound catabolic process GO:0034655
- ribosome biogenesis GO:0042254
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q3LXA3 | TKFC | 0.99624 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 immune system process GO:0002376 ... |
| 2 | P81605 | DCD | 0.94913 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 response to stress GO:0006950 |
| 3 | Q96G91 | P2RY11 | 0.91268 | response to stress GO:0006950 signal transduction GO:0007165 |
| 4 | P06396 | GSN | 0.88544 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 5 | Q8NCW0 | KREMEN2 | 0.83205 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 6 | O95182 | NDUFA7 | 0.82587 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | P25090 | FPR2 | 0.8061 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 8 | O15503 | INSIG1 | 0.76201 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | Q01581 | HMGCS1 | 0.74586 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q8NB78 | KDM1B | 0.73863 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVY STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD..........................DDDDDDDDDDD............................................ DO_IUPRED2A: D....D.D...D......................DDDDDDDDDDDDDDD...............................................DD.. DO_SPOTD: DDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDD.D............................................ CONSENSUS: DDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDD............................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDD...................................DDDDDDDDD........................................ RICH_[A]: AepAsvAAeslAgsrArA RICH_MOBI_[A]: AepAsvAAeslA
120 140 160 180 200 AA: WVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLF STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 AA: KVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES STMI: DO_DISOPRED3: ........................................................................... DO_IUPRED2A: ........................................................................... DO_SPOTD: .........................................................................DD CONSENSUS: ........................................................................... CONSENSUS_MOBI: ...........................................................................