Q96KF7 SMIM8_HUMAN
Gene name: SMIM8
Protein name: Small integral membrane protein 8
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6NI79 | CCDC69 | 0.75676 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 2 | Q96BD8 | SKA1 | 0.7263 | cell cycle GO:0007049 cell division GO:0051301 chromosome segregation GO:0007059 ... |
| 3 | P31948 | STIP1 | 0.68624 | |
| 4 | Q9UHP9 | SMPX | 0.66975 | |
| 5 | Q99576 | TSC22D3 | 0.66388 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q13231 | CHIT1 | 0.65879 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 immune system process GO:0002376 ... |
| 7 | Q9BXI3 | NT5C1A | 0.63818 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q9H5V8 | CDCP1 | 0.61516 | |
| 9 | Q8N967 | LRTM2 | 0.60938 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
| 10 | Q5VIR6 | VPS53 | 0.60011 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
20 40 60 80 AA: MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFRAVNPELFIKPNKPVMAFGLVTLSLCVAYIGYLHAIQENKKDLYEAIDSEGHSYMRRKTSKWD STMI: MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDD...................................................................D..... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................DD....DDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD....................... .....................D..... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDD....................... ........................... RICH_[P]: PePPtfkkePPkekefqsP RICH_[EK]: EpptfKKEppKEKE RICH_[EP]: PEPPtfkkEPPkEkEfqsP RICH_[KP]: PePPtfKKePPKeKefqsP RICH_MOBI_[P]: PePPtfkkePPkekefqsP RICH_MOBI_[EF]: EpptFkkEppkEkEF RICH_MOBI_[EK]: EpptfKKEppKEKE RICH_MOBI_[EP]: PEPPtfkkEPPkEkEfqsP RICH_MOBI_[FK]: FKKeppKeKeF RICH_MOBI_[FP]: PePPtFkkePPkekeFqsP RICH_MOBI_[KP]: PePPtfKKePPKeKefqsP