Q9UHP9 SMPX_HUMAN

Gene name: SMPX
Protein name: Small muscular protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96BD8 SKA1 0.79518 cell cycle GO:0007049
cell division GO:0051301
chromosome segregation GO:0007059
...
2 A6NI79 CCDC69 0.7778 cell cycle GO:0007049
cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
3 Q96KF7 SMIM8 0.66975
4 Q5VIR6 VPS53 0.64748 protein transport GO:0015031
transport GO:0006810
vesicle-mediated transport GO:0016192
5 A8MTA8 FAM166B 0.61721
6 Q6ZN54 DEF8 0.59282 cellular component assembly GO:0022607
homeostatic process GO:0042592
signal transduction GO:0007165
7 Q14028 CNGB1 0.58981 anatomical structure development GO:0048856
cell differentiation GO:0030154
homeostatic process GO:0042592
...
8 Q06187 BTK 0.58933 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
9 Q14839 CHD4 0.58838 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
10 Q9H5V8 CDCP1 0.58236

                                           20                  40                  60                  80            
AA:                      MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ
STMI:                                                                                                            
DO_DISOPRED3:            DDDDDD.................................DDDDDDDDDDDDD...................................D
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D....DDDD.DD.DD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDDDDDDDD
CONSENSUS_MOBI:          .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
RICH_[E]:                                                    EctpEvEEgvpptsdEE                                   
RICH_[N]:                 NmskqpvsNvraiqaNiN                                                                     
RICH_[P]:                                                              PPtsdeekkPiPgakklPgP                      
RICH_[EK]:                                                         EEgvpptsdEEKKpipgaKK                          
RICH_[EP]:                                         PgagqPPrrkEctPEvEEgvPPtsdE                                    
RICH_[IN]:                        NvraIqaNINI                                                                    
RICH_[KP]:                                                             PPtsdeeKKPiPgaKKlPgP                      
RICH_[MN]:               MNMskqpvsN                                                                              
RICH_MOBI_[E]:                                               EctpEvEEgvpptsdEE                                   
RICH_MOBI_[P]:                                                         PPtsdeekkPiPgakklPgP                      
RICH_MOBI_[EK]:                                                    EEgvpptsdEEKKpipgaKK                          
RICH_MOBI_[EV]:                                              EctpEVEEgV                                          
RICH_MOBI_[KP]:                                                        PPtsdeeKKPiPgaKKlPgP