Q96L33 RHOV_HUMAN
Gene name: RHOV
Protein name: Rho-related GTP-binding protein RhoV
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell morphogenesis GO:0000902
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q2PZI1 | DPY19L1 | 0.96072 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 2 | P51512 | MMP16 | 0.90749 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 3 | P30793 | GCH1 | 0.89035 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q9NYG8 | KCNK4 | 0.86478 | nervous system process GO:0050877 transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | Q96A11 | GAL3ST3 | 0.85229 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 6 | A0A1B0GTJ6 | LOC101059948 | 0.85012 | |
| 7 | Q13275 | SEMA3F | 0.84382 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
| 8 | Q9UJM3 | ERRFI1 | 0.83369 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | Q96MX3 | ZNF48 | 0.82858 | |
| 10 | O75949 | FAM155B | 0.82788 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 100 AA: MPPRELSEAEPPPLRAPTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCY STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... RICH_[PR]: RelseaePPPlRaPtPPPRRRsaPP RICH_[P]: PPrelseaePPPlraPtPPPrrrsaPP RICH_[R]: RelseaeppplRaptpppRRR RICH_fLPS_[P]: PPrelseaePPPlraPtPPPrrrsaPP RICH_MOBI_[PR]: RelseaePPPlRaPtPPPRRRsaP RICH_MOBI_[P]: PPrelseaePPPlraPtPPPrrrsaP RICH_MOBI_[R]: RelseaeppplRaptpppRRR RICH_fLPS_MOBI_[P]: PPrelseaePPPlraPtPPPrrrsaP
120 140 160 180 200 AA: PDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDS STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ................................................................DDDDDD.............................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: AILSAIEHKARLEKKLNAKGVRTLSRCRWKKFFCFV STMI: DO_DISOPRED3: .........DDDDDDDDDDDDDDDDDDD........ DO_IUPRED2A: .................................... DO_SPOTD: .........DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .........DDDDDDDDDDDDDDDDDDD........ CONSENSUS_MOBI: ....................................