P30793 GCH1_HUMAN

Gene name: GCH1
Protein name: GTP cyclohydrolase 1

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- circulatory system process GO:0003013
- immune system process GO:0002376
- nervous system process GO:0050877
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- small molecule metabolic process GO:0044281

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q2PZI1 DPY19L1 0.89343 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
2 Q96L33 RHOV 0.89035 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
3 Q5JNZ5 RPS26P11 0.88491 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
4 Q9BQ89 FAM110A 0.8799
5 Q13275 SEMA3F 0.84901 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
6 P51512 MMP16 0.83338 anatomical structure development GO:0048856
catabolic process GO:0009056
cell population proliferation GO:0008283
...
7 Q9NYG8 KCNK4 0.82896 nervous system process GO:0050877
transmembrane transport GO:0055085
transport GO:0006810
8 Q9BYE0 HES7 0.8242 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 O00459 PIK3R2 0.81014 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
10 Q9H013 ADAM19 0.80968 anatomical structure development GO:0048856
cell adhesion GO:0007155
extracellular matrix organization GO:0030198
...

                                           20                  40                  60                  80                 100
AA:                      MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAAS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........D.........DDDDDD......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................
RICH_[PR]:                           PRgaRcsngfPeRdPPRPgPsRP                                                                 
RICH_[AP]:                                              PsrPAekPPrPeAksAqPA                                                  
RICH_[E]:                                                                       ErprsEEdnE                                   
RICH_[P]:                            PrgarcsngfPerdPPrPgPsrP                                                                 
RICH_[R]:                      RapaekpRgaRcsngfpeR                                                                           
RICH_fLPS_[P]:                                 PerdPPrPgPsrPaekPPrP                                                          
RICH_MOBI_[PR]:                      PRgaRcsngfPeRdPPRPgPsR                                                                  
RICH_MOBI_[AP]:                                         PsrPAekPPrPeAksAqPA                                                  
RICH_MOBI_[P]:                       PrgarcsngfPerdPPrPgPsrP                                                                 
RICH_MOBI_[R]:                 RapaekpRgaRcsngfpeR                                                                           
RICH_fLPS_MOBI_[P]:                            PerdPPrPgPsrPaekPPrP                                                          

                                          120                 140                 160                 180                 200
AA:                      AMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPA
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          220                 240          
AA:                      GVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
STMI:                                                                      
DO_DISOPRED3:            ..................................................
DO_IUPRED2A:             ..................................................
DO_SPOTD:                ..................................................
CONSENSUS:               ..................................................
CONSENSUS_MOBI:          ..................................................