Q9BQ24 ZFY21_HUMAN
Gene name: ZFYVE21
Protein name: Zinc finger FYVE domain-containing protein 21
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96L58 | B3GALT6 | 0.93912 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 2 | Q5T9C9 | PIP5KL1 | 0.91616 | cell death GO:0008219 cellular protein modification process GO:0006464 |
| 3 | Q8N6K7 | SAMD3 | 0.90286 | |
| 4 | Q9GZY8 | MFF | 0.86513 | anatomical structure development GO:0048856 cell death GO:0008219 protein targeting GO:0006605 ... |
| 5 | Q13393 | PLD1 | 0.86193 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 6 | Q96LR9 | APOLD1 | 0.848 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 7 | P41181 | AQP2 | 0.84549 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 8 | A0A1B0GTL2 | C20orf204 | 0.84215 | |
| 9 | Q9Y2T4 | PPP2R2C | 0.83761 | cellular protein modification process GO:0006464 |
| 10 | Q13868 | EXOSC2 | 0.83205 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 growth GO:0040007 ... |
20 40 60 80 100 AA: MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCGKCFCDRCCSQKVPLRRMCFVDPVRQCAECA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD.............................................................. DO_IUPRED2A: .DD................................................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[R]: RRdakklvRspsglRmvpehR
120 140 160 180 200 AA: LVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRLSNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLK STMI: DO_DISOPRED3: ...................DDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDD....................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .............................D...................................................................... CONSENSUS: .............................D...................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: LTVVEDVTVGRRQAVAWLVAMHKAAKLLYESRDQ STMI: DO_DISOPRED3: ...............................DDD DO_IUPRED2A: .................................. DO_SPOTD: ...............................DDD CONSENSUS: ...............................DDD CONSENSUS_MOBI: ..................................